BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0460 (630 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0314 - 14238620-14240128 28 5.3 03_06_0653 - 35305279-35306163 28 7.0 >04_03_0314 - 14238620-14240128 Length = 502 Score = 28.3 bits (60), Expect = 5.3 Identities = 27/87 (31%), Positives = 38/87 (43%), Gaps = 2/87 (2%) Frame = +2 Query: 191 HARHRYLCRVPHHIRWCGRGLLMQTPSHKRIDIFYSLVGVALFVASGAIIIDRFQHYGKS 370 H R R L VP +R+ L Q P+ + S + VAL A+ A+ D G S Sbjct: 119 HRRRRPL--VPFVLRYPALFRLFQAPTSHPLSPNLSTLAVALTPAAEALAADLAALRGSS 176 Query: 371 EIKDKNLAKAS--LAIINGAILLVDAV 445 E+ + AK L + G LLV + Sbjct: 177 ELAPRLAAKMHRLLLLAPGRSLLVSKI 203 >03_06_0653 - 35305279-35306163 Length = 294 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -2 Query: 251 ARGRTSEYDEVPDKGTGDEHADIRICIVTVVVESHARTRKCQLQKL 114 A +SE + D GDE A R C E+ R +CQ +K+ Sbjct: 175 AASSSSEEEAACDDDDGDECAARRWCCAREYFEAKERWEECQFKKM 220 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,197,001 Number of Sequences: 37544 Number of extensions: 342068 Number of successful extensions: 817 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1537558360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -