BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0458 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57854| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_24761| Best HMM Match : LRR_1 (HMM E-Value=0.0056) 29 4.9 SB_52655| Best HMM Match : MFS_1 (HMM E-Value=0) 28 6.5 >SB_57854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 32.7 bits (71), Expect = 0.30 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = +1 Query: 421 PGTA*STIKLNFLAFSFFQQHFLQKL*IKVLTESPRSIETIF 546 PG A ++++ L +SFF+Q FL+ K+LTE R I T+F Sbjct: 233 PGKAIVSLEMASLTWSFFKQSFLK----KILTEGERFIMTLF 270 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -3 Query: 388 YKGTIGKYE*RKYNLRRTFEDKKEQC 311 Y TIG YE R + RRT+E EQC Sbjct: 470 YSSTIGNYERRTSSNRRTYEGTTEQC 495 >SB_24761| Best HMM Match : LRR_1 (HMM E-Value=0.0056) Length = 298 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 143 RRRVNLTSWVWPHDIVIKRYILIYAIPWT 229 R R+ +S+ WP D+ ++L+ A+PWT Sbjct: 127 RSRLRASSY-WPRDVGNLSHLLLKAVPWT 154 >SB_52655| Best HMM Match : MFS_1 (HMM E-Value=0) Length = 839 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = +3 Query: 219 YLGLLLRMSS*STRQSLDVKALDLWIFVMFSHCSFLSSNVLLKLYFLYSYFPIVPLYL 392 ++G SS + + LD+K+L+ + F S S VLL L Y++F I ++L Sbjct: 259 FIGACALASSIVSGRVLDIKSLNPFFVNQFGAVSMGMSMVLLPLATQYTHFVIFSVFL 316 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = +3 Query: 219 YLGLLLRMSS*STRQSLDVKALDLWIFVMFSHCSFLSSNVLLKLYFLYSYFPIVPLYL 392 ++G SS + + LD+K+L+ + F S S VLL L Y++F I ++L Sbjct: 670 FIGACALASSIVSGRVLDIKSLNPFFVNQFGAVSMGMSMVLLPLATQYTHFVIFSVFL 727 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,869,243 Number of Sequences: 59808 Number of extensions: 459753 Number of successful extensions: 1041 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -