BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0458 (708 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-886|AAZ66447.1| 7744|Drosophila melanogaster CG33715-PB... 29 8.2 AE014134-885|AAZ66446.1| 11707|Drosophila melanogaster CG33715-P... 29 8.2 >AE014134-886|AAZ66447.1| 7744|Drosophila melanogaster CG33715-PB, isoform B protein. Length = 7744 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = -3 Query: 424 REWVVFHCNISRYKGTIGKYE*--RKYNLRRTFEDKKEQCENITKIQRS 284 ++W + N+ R +G+ E + YNL+ +FE+K+EQ + ++ Sbjct: 3754 QQWNDYEINLDRLITWLGEAENSLKNYNLKSSFEEKEEQLNGFQSLAQN 3802 >AE014134-885|AAZ66446.1| 11707|Drosophila melanogaster CG33715-PD, isoform D protein. Length = 11707 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = -3 Query: 424 REWVVFHCNISRYKGTIGKYE*--RKYNLRRTFEDKKEQCENITKIQRS 284 ++W + N+ R +G+ E + YNL+ +FE+K+EQ + ++ Sbjct: 3754 QQWNDYEINLDRLITWLGEAENSLKNYNLKSSFEEKEEQLNGFQSLAQN 3802 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,328,469 Number of Sequences: 53049 Number of extensions: 644236 Number of successful extensions: 1392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1388 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3128965752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -