BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0452 (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 25 2.5 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 24 3.3 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 5.8 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 7.7 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 163 ILQEKIPKEQEKIREFRKKHGST 231 +L EK+ KE K+R F KK +T Sbjct: 247 LLCEKVVKEDIKVRFFEKKGNAT 269 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 460 KRCLKNGQRGRSYRLTC 510 +RCLK GQ +YR C Sbjct: 266 QRCLKEGQAKNTYRKGC 282 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.4 bits (48), Expect = 5.8 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +3 Query: 357 CQQQLPKAKGGEEPLPEGLFW 419 C LP+ KGG P +W Sbjct: 254 CDTSLPRRKGGPYPRRRAYWW 274 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +3 Query: 360 QQQLPKAKGGEEPLPEGLFWLLVTGDIPTEAQ 455 QQQ +++ ++ P+ L W V P++ Q Sbjct: 401 QQQQQQSQQQQQQQPQQLLWTTVVRSCPSQRQ 432 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,493 Number of Sequences: 2352 Number of extensions: 10949 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -