BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0448 (702 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0539 - 18416184-18416830,18417983-18419057 32 0.38 06_03_1229 + 28571131-28571235,28572108-28572656,28572749-285729... 31 1.2 11_06_0616 + 25546175-25546359,25546778-25546837,25546939-255469... 29 4.7 02_02_0421 - 10042184-10042197,10042442-10042822,10044158-100442... 29 4.7 06_03_0675 - 23428948-23431389 28 8.3 05_06_0106 - 25611239-25611295,25611388-25611477,25611582-256116... 28 8.3 >09_04_0539 - 18416184-18416830,18417983-18419057 Length = 573 Score = 32.3 bits (70), Expect = 0.38 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 416 EPQNDYCENNANNDRPTQWSS 478 E +N+ CEN+ANN T+WSS Sbjct: 365 EMRNETCENSANNHSETEWSS 385 >06_03_1229 + 28571131-28571235,28572108-28572656,28572749-28572918, 28573454-28573669,28573787-28573946 Length = 399 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 632 DSTLPKYICHICGKSFRQQSAHA 700 DST Y C +CGK +R AHA Sbjct: 61 DSTPMLYSCALCGKEYRSSKAHA 83 >11_06_0616 + 25546175-25546359,25546778-25546837,25546939-25546957, 25547948-25547998,25548097-25548230,25548558-25548948, 25549840-25549890 Length = 296 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 598 ANQLSCICDIGLFYLWLN*DKQVTLCYRDH 509 A +LS +CDI L L + + + T+C DH Sbjct: 32 AKELSILCDIPLILLMFSPNDKPTICVGDH 61 >02_02_0421 - 10042184-10042197,10042442-10042822,10044158-10044261, 10044634-10044734,10044806-10045147,10045981-10046158, 10047696-10047776,10049190-10049449 Length = 486 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/79 (21%), Positives = 34/79 (43%) Frame = -2 Query: 323 PFEIVSHIVKVCNKHCTNT*ETHIFADVDVSKCSHIVR*ISRTVRSINGYSAFF*TYSAF 144 P ++SH V NK+ + +T +D +++ ++R R + ++ Y F Sbjct: 38 PSNLLSHEVITWNKNLLHIEKTSHNGTLDPKVTGNLIVCVNRATRLVKSWNGVMLKYVLF 97 Query: 143 SKICNGFSFSHFTMMIYYC 87 ++ S S M+ YC Sbjct: 98 KRVGYIESLSLMIRMLLYC 116 >06_03_0675 - 23428948-23431389 Length = 813 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 183 YGPDCSTDLSYDVRTFGDIDIS 248 YGP+CS + Y + F DI S Sbjct: 427 YGPNCSAENQYSIANFSDISRS 448 >05_06_0106 - 25611239-25611295,25611388-25611477,25611582-25611669, 25611757-25611836,25611968-25612120,25612403-25612546, 25612633-25612884,25612985-25613116,25613207-25613287, 25613368-25613488,25613930-25614025,25614195-25614298, 25614481-25614567,25614690-25614803,25614871-25614930, 25615007-25615102,25615316-25615366,25615457-25615562, 25615642-25615713,25616117-25616172,25616446-25616508, 25616636-25616764 Length = 743 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -1 Query: 75 LCSFVMVIVHITTFSLRLVHIIK 7 LC+F ++++ + FS+RL +IK Sbjct: 24 LCAFTLLLIGVLAFSIRLFSVIK 46 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,557,476 Number of Sequences: 37544 Number of extensions: 304093 Number of successful extensions: 696 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -