BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0448 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49500.1 68416.m05410 RNA-dependent RNA polymerase (SDE1) ide... 29 2.3 At4g30580.1 68417.m04339 phospholipid/glycerol acyltransferase f... 28 5.2 At1g53550.1 68414.m06076 F-box family protein similar to F-box f... 27 9.1 >At3g49500.1 68416.m05410 RNA-dependent RNA polymerase (SDE1) identical to RNA-dependent RNA polymerase [Arabidopsis thaliana] gi|8248473|gb|AAF74208 Length = 1196 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -2 Query: 377 QNCFSKLIHSRVFRIV*LPFEIVSHIVKVCNKHCTNT*ETHIFADVDVSKCSHI 216 +NCFSK H F+ E+V V + C + + I VDV + H+ Sbjct: 790 ENCFSK--HGSRFKETKTDLEVVKGYVAIAKNPCLHPGDVRILEAVDVPQLHHM 841 >At4g30580.1 68417.m04339 phospholipid/glycerol acyltransferase family protein Length = 356 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 437 ENNANNDRPTQWSSVQQYFLDLSNVISIT*SYLFVS 544 EN ++D P + S Q FLD+ ++S+ S+ F+S Sbjct: 187 ENLPSSDTPAVYVSNHQSFLDIYTLLSLGKSFKFIS 222 >At1g53550.1 68414.m06076 F-box family protein similar to F-box family protein TIGR_Ath1:At3g23960 Length = 408 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/38 (28%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -3 Query: 658 TNVFRQSRVVDSIVISTMSFANQL-SCICDIGLFYLWL 548 T++ + ++ ++ S + + +L +CICD LF LW+ Sbjct: 270 TSIDKDMTIMTNLSFSLIDYKGKLGACICDHTLFELWV 307 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,145,946 Number of Sequences: 28952 Number of extensions: 273677 Number of successful extensions: 688 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -