BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0439 (612 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031629-6|CAA20980.2| 948|Caenorhabditis elegans Hypothetical ... 35 0.053 >AL031629-6|CAA20980.2| 948|Caenorhabditis elegans Hypothetical protein Y106G6D.7 protein. Length = 948 Score = 34.7 bits (76), Expect = 0.053 Identities = 23/80 (28%), Positives = 36/80 (45%) Frame = +3 Query: 15 SDK*KNKMTSTPFNVGLNDGARLSSRVLRPPGGGHTNIFDSEPEPPRTGRRAVPPSATST 194 S+K KN + FN N G + + P T++ ++ PP+TGR+ + P+ + Sbjct: 286 SNKYKNNYKAPEFNNDFNGGNKFNQ--FPPRNAQSTDLSENRAAPPQTGRKTLMPTPQAP 343 Query: 195 FSHGQGDEPKATNGTSVATN 254 F Q TNG S N Sbjct: 344 F---QNAPAPFTNGPSDDVN 360 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,223,041 Number of Sequences: 27780 Number of extensions: 256375 Number of successful extensions: 790 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -