BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0438 (781 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 2.4 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 4.2 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 4.2 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 4.2 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 7.4 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 567 ERGCNSTNKISTFVYWQENTMEGH 638 ER CN ++ F+ W E E + Sbjct: 248 ERLCNRLGRVKRFINWHEPIPEAY 271 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 564 IERGCNSTNKISTFVYWQENTME 632 IER +T+KI + W E +E Sbjct: 375 IERNSGATDKIIRWCTWSEGDLE 397 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 564 IERGCNSTNKISTFVYWQENTME 632 IER +T+KI + W E +E Sbjct: 375 IERNSGATDKIIRWCTWSEGDLE 397 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 564 IERGCNSTNKISTFVYWQENTME 632 IER +T+KI + W E +E Sbjct: 375 IERNSGATDKIIRWCTWSEGDLE 397 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 7.4 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +3 Query: 411 NPKVMIRRVIVTVILMIQKRKNYKGNLKELLW*ETSCEVE 530 N K+ R+I+ I I R N K +K LL EVE Sbjct: 208 NVKLKELRIILEDIKHINTRHNTKNGMKTLLSETDIWEVE 247 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,395 Number of Sequences: 438 Number of extensions: 3943 Number of successful extensions: 43 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -