BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0435 (758 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 143 2e-34 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 92 4e-19 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 87 1e-17 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 3e-17 SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 8e-17 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 79 4e-15 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 79 5e-15 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 71 1e-12 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19) 71 1e-12 SB_55073| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19) 71 1e-12 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 68 1e-11 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 66 2e-11 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 66 2e-11 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 65 5e-11 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 64 9e-11 SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27) 63 2e-10 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 63 2e-10 SB_21307| Best HMM Match : Helicase_C (HMM E-Value=1.7e-11) 62 5e-10 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 60 1e-09 SB_4445| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_30394| Best HMM Match : Helicase_C (HMM E-Value=1e-20) 59 4e-09 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 58 8e-09 SB_58021| Best HMM Match : Helicase_C (HMM E-Value=0.017) 58 1e-08 SB_24297| Best HMM Match : Helicase_C (HMM E-Value=0.017) 58 1e-08 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 57 1e-08 SB_36976| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_8614| Best HMM Match : Helicase_C (HMM E-Value=1.6e-18) 49 5e-06 SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) 49 5e-06 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 46 3e-05 SB_21060| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_56809| Best HMM Match : DEAD (HMM E-Value=2.6e-19) 46 4e-05 SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) 42 7e-04 SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) 40 0.002 SB_47844| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59278| Best HMM Match : Helicase_C (HMM E-Value=0.00034) 37 0.020 SB_23184| Best HMM Match : Helicase_C (HMM E-Value=7.8e-23) 36 0.047 SB_49443| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.082 SB_28817| Best HMM Match : DEAD (HMM E-Value=3.4e-32) 33 0.19 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 33 0.25 SB_1038| Best HMM Match : Helicase_C (HMM E-Value=1.1e-10) 33 0.33 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 31 0.77 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_32823| Best HMM Match : Late_protein_L1 (HMM E-Value=2.5) 29 5.4 SB_43422| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_1215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) 28 9.5 SB_23095| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 143 bits (346), Expect = 2e-34 Identities = 64/85 (75%), Positives = 78/85 (91%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTG 434 DR+QRERE+ALR FR G TPILVATAVAARGLDIP+V+HVINFDLP+D+EEYVHRIGRTG Sbjct: 1133 DRSQREREEALRTFRCGDTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIGRTG 1192 Query: 435 RMGNLGVATSFFNDTNRGLARDLVD 509 R+G+ G+ATSFFN N+ +A++L+D Sbjct: 1193 RVGHTGLATSFFNHKNKNVAKELMD 1217 Score = 72.9 bits (171), Expect = 3e-13 Identities = 41/64 (64%), Positives = 45/64 (70%) Frame = +2 Query: 2 LYNYVFLAVGRVGSTSENITQKVVWVDEMDKRSFXXXXXXXXXXXQRARPEEDQLILVFV 181 L NY+FLAVG+VGSTSENITQKVVWVDE DKRSF + P+ QL LVFV Sbjct: 1056 LENYIFLAVGKVGSTSENITQKVVWVDEFDKRSF------LLDLLNASGPQ--QLTLVFV 1107 Query: 182 ETKK 193 ETKK Sbjct: 1108 ETKK 1111 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 Query: 190 EGADQLEEYLYSQGYPVTSIHG 255 +GAD LE +L GY TSIHG Sbjct: 1111 KGADALEMFLAKDGYYCTSIHG 1132 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 509 LLVEAKQDVPNWLTSTAADXXXXXXXXXXXXXXXNARYGGSG--FGSRDFR 655 +L E+KQ++P+WL S A + R+GG G F SRD+R Sbjct: 1218 ILEESKQEIPSWLESMAYE-------ASSGSRNRGRRHGGGGGAFSSRDYR 1261 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 116 bits (280), Expect = 2e-26 Identities = 58/93 (62%), Positives = 71/93 (76%), Gaps = 1/93 (1%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTG 434 DR Q+ERE+AL FR G+ P+L+AT VAARGLDI V+HVINFDLPSD++EYVHRIGRTG Sbjct: 995 DRLQQEREEALDDFRKGRCPVLIATNVAARGLDIDDVKHVINFDLPSDIDEYVHRIGRTG 1054 Query: 435 RMGNLGVATSFF-NDTNRGLARDLVDCSSRLNK 530 R+GN G AT+FF + +AR LV S N+ Sbjct: 1055 RIGNKGKATTFFLRGRDDKVARGLVKVLSEANQ 1087 Score = 35.9 bits (79), Expect = 0.036 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +2 Query: 2 LYNYVFLAVGRVGSTSENITQKVVWVDEMDKR 97 L +Y+FL VGRVG T+ +I Q V+ V + +KR Sbjct: 919 LNDYLFLTVGRVGGTTSDIEQTVIEVTDNEKR 950 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 92.3 bits (219), Expect = 4e-19 Identities = 43/82 (52%), Positives = 54/82 (65%) Frame = +3 Query: 258 RNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGR 437 RNQ +RE AL + G ILVAT VA RG+DI V HVIN+D+ +E+Y HRIGRTGR Sbjct: 318 RNQEQREFALSSLKGGSKDILVATDVAGRGIDIKDVSHVINYDMAKTIEDYTHRIGRTGR 377 Query: 438 MGNLGVATSFFNDTNRGLARDL 503 G G+A SF ++ G+ DL Sbjct: 378 AGKTGIAVSFLTQSDSGVFYDL 399 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 87.4 bits (207), Expect = 1e-17 Identities = 40/71 (56%), Positives = 52/71 (73%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTG 434 ++ Q R ++ FR G+ ILVAT VA+RGLD P V HVIN+DLP +E Y+HR GRTG Sbjct: 365 EKPQDYRFKLVKAFRDGKVDILVATDVASRGLDFPEVTHVINYDLPDTIECYIHRCGRTG 424 Query: 435 RMGNLGVATSF 467 R+G+ G+ATSF Sbjct: 425 RIGHHGIATSF 435 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 86.2 bits (204), Expect = 3e-17 Identities = 40/83 (48%), Positives = 57/83 (68%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTG 434 D Q+ERE ++ FR GQ+ +L++T V ARGLD+ V VIN+DLP++ E Y+HRIGR+G Sbjct: 269 DMPQKEREAIMKDFRAGQSRVLISTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSG 328 Query: 435 RMGNLGVATSFFNDTNRGLARDL 503 R G GVA +F + + RD+ Sbjct: 329 RFGRKGVAINFVKSDDIRILRDI 351 >SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 84.6 bits (200), Expect = 8e-17 Identities = 40/89 (44%), Positives = 57/89 (64%) Frame = +3 Query: 264 QREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMG 443 Q +RE AL F+TG IL+AT VA+RGLDI + +VIN+D P +E+YVHR+GRTGR G Sbjct: 78 QYDREQALDDFKTGLARILIATDVASRGLDIKDITYVINYDFPRHIEDYVHRVGRTGRAG 137 Query: 444 NLGVATSFFNDTNRGLARDLVDCSSRLNK 530 G + +F + + A L+ + N+ Sbjct: 138 RSGTSLTFISREDWRSAHKLIKIMVQANQ 166 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 79.0 bits (186), Expect = 4e-15 Identities = 38/79 (48%), Positives = 49/79 (62%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTG 434 D Q++RE L+ FR G+ LVAT VAARGLDIP + V+ + P DV+ Y+HR GRTG Sbjct: 337 DIPQKQREVTLKSFREGKFRCLVATDVAARGLDIPEIDLVVQCEPPKDVDAYIHRSGRTG 396 Query: 435 RMGNLGVATSFFNDTNRGL 491 R G G+ F+ GL Sbjct: 397 RAGREGICIVFYKPQQEGL 415 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 78.6 bits (185), Expect = 5e-15 Identities = 37/68 (54%), Positives = 50/68 (73%) Frame = +3 Query: 261 NQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRM 440 +Q ER AL RF++G ILVAT VA+RGLDIP V V+N ++P+D ++Y+HR+GRT R Sbjct: 282 SQGERLAALARFKSGTIKILVATDVASRGLDIPQVELVVNSNIPADPKDYIHRVGRTARA 341 Query: 441 GNLGVATS 464 G G+A S Sbjct: 342 GRGGMAIS 349 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 70.9 bits (166), Expect = 1e-12 Identities = 34/74 (45%), Positives = 48/74 (64%), Gaps = 6/74 (8%) Frame = +3 Query: 270 EREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLP------SDVEEYVHRIGRT 431 +R L RFR G+ +L+ T V+ARG+D+ V VIN+D+P +D E Y+HRIGRT Sbjct: 382 QRIAVLERFRLGKEKLLITTNVSARGIDVEQVTLVINYDMPMDMQGKADFETYLHRIGRT 441 Query: 432 GRMGNLGVATSFFN 473 GR G G+A +F + Sbjct: 442 GRFGKSGIAVNFID 455 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 70.9 bits (166), Expect = 1e-12 Identities = 33/65 (50%), Positives = 45/65 (69%) Frame = +3 Query: 264 QREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMG 443 QR+R L RF+ T +L+AT VAARGLDI ++ HVI++ +P D E YVHR GRT R Sbjct: 492 QRQRLKNLDRFKASNTGLLLATDVAARGLDIANIEHVIHYQVPKDPEVYVHRSGRTARAS 551 Query: 444 NLGVA 458 + G++ Sbjct: 552 HEGLS 556 >SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19) Length = 445 Score = 70.5 bits (165), Expect = 1e-12 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGR 428 D++Q ER A+R F G +LVAT VA++GLD P ++HVINFD+P D+E YV G+ Sbjct: 120 DKSQEERVHAIREFHQGNKDVLVATDVASKGLDFPDIQHVINFDMPEDIENYVLLCGQ 177 >SB_55073| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19) Length = 212 Score = 70.5 bits (165), Expect = 1e-12 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGR 428 D++Q ER A+R F G +LVAT VA++GLD P ++HVINFD+P D+E YV G+ Sbjct: 120 DKSQEERVHAIREFHQGNKDVLVATDVASKGLDFPDIQHVINFDMPEDIENYVLLCGQ 177 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 67.7 bits (158), Expect = 1e-11 Identities = 32/97 (32%), Positives = 52/97 (53%) Frame = +3 Query: 186 LRRCGSTRRIFIFPRLPGNIDPWDRNQREREDALRRFRTGQTPILVATAVAARGLDIPHV 365 ++RC + + + P Q ER ++F+ + +LVAT + RG+DI V Sbjct: 345 VQRCTALSHLLLKQNFPAICIHRGMKQEERLARYQQFKNFEKRMLVATNLFGRGMDIERV 404 Query: 366 RHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFND 476 V N+D+P D + Y+HR+ R GR G G+A +F +D Sbjct: 405 NIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSD 441 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 66.5 bits (155), Expect = 2e-11 Identities = 33/75 (44%), Positives = 43/75 (57%) Frame = +3 Query: 261 NQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRM 440 +Q R FR G LV + + RG+DI V VINFD P + E Y+HRIGR+GR Sbjct: 326 SQSHRNRVFHDFRQGHCRNLVCSDLFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRF 385 Query: 441 GNLGVATSFFNDTNR 485 G+LGVA + +R Sbjct: 386 GHLGVAINLITYDDR 400 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 66.5 bits (155), Expect = 2e-11 Identities = 33/75 (44%), Positives = 43/75 (57%) Frame = +3 Query: 261 NQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRM 440 +Q R FR G LV + + RG+DI V VINFD P + E Y+HRIGR+GR Sbjct: 326 SQSHRNRVFHDFRQGHCRNLVCSDLFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRF 385 Query: 441 GNLGVATSFFNDTNR 485 G+LGVA + +R Sbjct: 386 GHLGVAINLITYDDR 400 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 65.3 bits (152), Expect = 5e-11 Identities = 28/61 (45%), Positives = 41/61 (67%) Frame = +3 Query: 267 REREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGN 446 R R + +F+ ILV T +A+RGLD V HVINFD P+ + +Y+HR+GRTGR+ + Sbjct: 733 RIRCERFEKFQNKTADILVCTDIASRGLDTSDVSHVINFDFPNSMVDYIHRVGRTGRVSH 792 Query: 447 L 449 + Sbjct: 793 V 793 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 64.5 bits (150), Expect = 9e-11 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = +3 Query: 285 LRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATS 464 LR FRTGQ +LV T RGLD + HV ++P +VEEY+H GR GR G G AT+ Sbjct: 471 LRDFRTGQIQLLVGTEETVRGLDFKELDHVYLMEVPKNVEEYLHLCGRVGRQGRPGTATT 530 >SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27) Length = 331 Score = 63.3 bits (147), Expect = 2e-10 Identities = 34/73 (46%), Positives = 43/73 (58%) Frame = +3 Query: 261 NQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRM 440 N+ + D+ R+ +G ILV T V ARG+DIP V VI +D PS +VHR GRT R+ Sbjct: 128 NRHKIFDSFRKLESG---ILVCTDVMARGVDIPEVNWVIQYDPPSSANAFVHRCGRTARI 184 Query: 441 GNLGVATSFFNDT 479 GN G A F T Sbjct: 185 GNEGNAVVFLLPT 197 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/70 (38%), Positives = 46/70 (65%) Frame = +3 Query: 258 RNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGR 437 + Q +R +A+ + ++ IL++T + ARG+D +V V+N D+P + E Y+HRIGR GR Sbjct: 248 QTQAKRLEAMEKLKSFHCRILISTDLTARGIDAENVNLVVNMDVPHNGETYLHRIGRAGR 307 Query: 438 MGNLGVATSF 467 G G+A ++ Sbjct: 308 FGTEGMAVTY 317 >SB_21307| Best HMM Match : Helicase_C (HMM E-Value=1.7e-11) Length = 87 Score = 62.1 bits (144), Expect = 5e-10 Identities = 26/63 (41%), Positives = 41/63 (65%) Frame = +3 Query: 288 RRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSF 467 ++F+ + +LVAT + RG+DI V V N+D+P D + Y+HR+ R GR G G+A +F Sbjct: 6 QQFKNFEKRMLVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITF 65 Query: 468 FND 476 +D Sbjct: 66 VSD 68 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 61.7 bits (143), Expect = 6e-10 Identities = 25/55 (45%), Positives = 40/55 (72%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHR 419 D +Q+ER+ ++ FR+G + +L+ T + ARG+D+ V VIN+DLPS+ E Y+HR Sbjct: 363 DMSQKERDIIMKEFRSGSSRVLITTDLLARGIDVHQVSLVINYDLPSNRENYIHR 417 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 60.5 bits (140), Expect = 1e-09 Identities = 25/57 (43%), Positives = 38/57 (66%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIG 425 DR Q +R++ ++ FRTG+ +L+AT + RG+D V VIN+D P+ Y+HRIG Sbjct: 416 DRTQAQRDNIVKSFRTGKIWVLIATELMGRGIDFKGVNLVINYDFPTSAVAYIHRIG 472 >SB_4445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/68 (42%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +3 Query: 336 AARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNDTNRGLARDLVDCS 515 A+RGLDIP+V HVI D +D + +HR+GRT R G+ G +F + L L C Sbjct: 108 ASRGLDIPNVTHVIQLDFATDAAQMLHRVGRTARAGSHGKVVNFITKDDEELVNALRACD 167 Query: 516 SRLN-KTY 536 + N KTY Sbjct: 168 NNSNEKTY 175 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/68 (42%), Positives = 42/68 (61%) Frame = +3 Query: 261 NQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRM 440 +Q R + +F+ +T ++V T VAARG+DIP + +VINF P + +VHR+GR R Sbjct: 510 DQTARTINVGKFQHKKTMVMVVTDVAARGIDIPMLDNVINFHFPPKAKLFVHRVGRVARA 569 Query: 441 GNLGVATS 464 G G A S Sbjct: 570 GRSGTAYS 577 >SB_30394| Best HMM Match : Helicase_C (HMM E-Value=1e-20) Length = 556 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = +3 Query: 315 ILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFF 470 ++VAT G+DIP V H+I+F +PS+VE YV IGR GR G L AT ++ Sbjct: 314 VVVATCALGMGVDIPDVDHIIHFGIPSEVEHYVQEIGRGGRDGRLCYATLYY 365 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 58.4 bits (135), Expect = 6e-09 Identities = 26/60 (43%), Positives = 38/60 (63%) Frame = +3 Query: 258 RNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGR 437 + Q++R F ++ IL+ T VAARGLDIP V ++ +D D +EY+HR+GRT R Sbjct: 852 QKQQKRTTTFFEFCNAKSGILLCTDVAARGLDIPEVDWIVQYDPADDPKEYIHRVGRTAR 911 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 58.0 bits (134), Expect = 8e-09 Identities = 36/102 (35%), Positives = 49/102 (48%) Frame = +3 Query: 201 STRRIFIFPRLPGNIDPWDRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVIN 380 S+ + IF D R R ++R R + V VA DI ++ VIN Sbjct: 305 SSLQTLIFTETKRRADELTRKLRSDGCGIQRPRYVSVDMAVVIMVA----DISDIKFVIN 360 Query: 381 FDLPSDVEEYVHRIGRTGRMGNLGVATSFFNDTNRGLARDLV 506 FD P+ E+YVHRIGRT R G + +FF N A++LV Sbjct: 361 FDFPNCTEDYVHRIGRTARSDRTGTSYTFFTVNNAKQAKELV 402 >SB_58021| Best HMM Match : Helicase_C (HMM E-Value=0.017) Length = 91 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +3 Query: 342 RGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNDTNR 485 RG+DI V VINFD P + E Y+HRIGR+GR G+LGVA + +R Sbjct: 5 RGIDIQSVNVVINFDFPKNSETYLHRIGRSGRFGHLGVAINLITYDDR 52 >SB_24297| Best HMM Match : Helicase_C (HMM E-Value=0.017) Length = 91 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +3 Query: 342 RGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNDTNR 485 RG+DI V VINFD P + E Y+HRIGR+GR G+LGVA + +R Sbjct: 5 RGIDIQSVNVVINFDFPKNSETYLHRIGRSGRFGHLGVAINLITYDDR 52 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/49 (51%), Positives = 34/49 (69%) Frame = +3 Query: 363 VRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNDTNRGLARDLVD 509 V VINFD+P EEYVH+IGR GR+G G + SF N+ ++GL L++ Sbjct: 397 VSKVINFDMPPTYEEYVHQIGRAGRLGATGWSISFINNASKGLFLQLIN 445 >SB_36976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = +3 Query: 345 GLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFF 470 G+DIP V H+I++ +PS+VE YV IGR GR G L AT ++ Sbjct: 2 GVDIPDVDHIIHYGIPSEVEHYVQEIGRGGRDGRLCHATLYY 43 >SB_8614| Best HMM Match : Helicase_C (HMM E-Value=1.6e-18) Length = 282 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/53 (41%), Positives = 30/53 (56%) Frame = +3 Query: 270 EREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGR 428 ++E L+ FR Q +LVAT+V GLD+P V+ FD P + YV GR Sbjct: 132 KQEKVLKMFRKHQINLLVATSVVEEGLDVPKCNFVVRFDFPQNFRSYVQSKGR 184 >SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) Length = 1366 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/58 (37%), Positives = 32/58 (55%) Frame = +3 Query: 270 EREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMG 443 +R +RF +G+ + AT GLD VR +I++++P E YV IGR GR G Sbjct: 826 QRRKVQKRFMSGELRAVAATVAFGMGLDKSDVRAIIHYNMPKSFESYVQEIGRAGRDG 883 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/59 (40%), Positives = 34/59 (57%) Frame = +3 Query: 261 NQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGR 437 +Q+E+ + + RFR G LV+T V GLDI V ++ FD + V R+GRTGR Sbjct: 565 SQKEQLEVVHRFRMGGYNTLVSTCVGEEGLDIGDVDLIVCFDAHASPIRLVQRMGRTGR 623 >SB_21060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 45.6 bits (103), Expect = 4e-05 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 2/93 (2%) Frame = +3 Query: 228 RLPGNIDP-WDRNQREREDALRRFRTG-QTPILVATAVAARGLDIPHVRHVINFDLPSDV 401 RL GN D QRE+E+ + +FR G + I++AT VA GLDI +VI +D+ + Sbjct: 588 RLVGNSDGRGGMTQREQEEVIAKFRAGSECNIIIATTVAEEGLDIDDCSYVIRYDMMGNE 647 Query: 402 EEYVHRIGRTGRMGNLGVATSFFNDTNRGLARD 500 V GR R G + T+ L R+ Sbjct: 648 ISSVQSRGRV-RTKTGGQYSVVVGQTSGALVRE 679 >SB_56809| Best HMM Match : DEAD (HMM E-Value=2.6e-19) Length = 1463 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/56 (37%), Positives = 33/56 (58%) Frame = +3 Query: 270 EREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGR 437 E+E L+ FRTG+ +L++T+V GLD+P V+ FD +++ V GR R Sbjct: 605 EQEVILKSFRTGRIKLLISTSVLEEGLDVPVCNLVVRFDSTMNLKSLVQSRGRASR 660 >SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) Length = 584 Score = 41.5 bits (93), Expect = 7e-04 Identities = 21/47 (44%), Positives = 32/47 (68%) Frame = +3 Query: 264 QREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVE 404 Q +R +AL++F+ G+ ILVAT +AARGLDI V++ + L + E Sbjct: 44 QLQRLEALQKFKNGEVDILVATDLAARGLDITGVKNSKSVTLVGEKE 90 >SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) Length = 2056 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = +3 Query: 264 QREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMG 443 + E+ + +++F++ L+AT G HV V + P + +V GR GR G Sbjct: 1079 ENEKIEVIKKFQSKDAQFLIATEAYQVGTHDDHVNLVCHVGCPRTLTSWVQEFGRGGRAG 1138 Query: 444 NLGVATSFFND 476 N A ++N+ Sbjct: 1139 NNAKAIIYYNE 1149 >SB_47844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +3 Query: 303 GQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVA 458 G +L+AT G+D V+ VI++ VE Y+ GR GR G+ VA Sbjct: 345 GTVRLLIATIAFGMGVDCKGVKRVIHYGPSKSVEAYIQETGRAGRDGSNSVA 396 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/30 (56%), Positives = 24/30 (80%) Frame = +2 Query: 8 NYVFLAVGRVGSTSENITQKVVWVDEMDKR 97 +Y+FLAVGRVG T+ +ITQ V+ V+ +KR Sbjct: 686 DYLFLAVGRVGGTNLDITQHVITVNGSEKR 715 >SB_36536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/42 (42%), Positives = 26/42 (61%) Frame = +3 Query: 261 NQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFD 386 +Q+E+E + F+ G IL+AT+VA GLDI VI +D Sbjct: 983 SQQEQELIIEEFKKGVVNILIATSVAEEGLDIKDCSFVIRYD 1024 >SB_59278| Best HMM Match : Helicase_C (HMM E-Value=0.00034) Length = 144 Score = 36.7 bits (81), Expect = 0.020 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +3 Query: 315 ILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSF 467 ++ AT G+D +VR V+ +P VE Y GR GR G+ V T + Sbjct: 80 VMCATKAFGLGIDQKNVRFVVPHIMPECVEHYYEEAGRAGRDGDPAVCTLY 130 >SB_23184| Best HMM Match : Helicase_C (HMM E-Value=7.8e-23) Length = 226 Score = 35.5 bits (78), Expect = 0.047 Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Frame = +3 Query: 270 EREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRI-GRTGRMGN 446 E++ + RF G++ +L++T V G+D+P+ ++ D +H++ GR GR GN Sbjct: 106 EKDLVMDRFIKGESQVLISTTVIEVGVDVPNATMMVIMDADRFGVSQLHQLRGRIGR-GN 164 Query: 447 L 449 L Sbjct: 165 L 165 >SB_49443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 495 Score = 34.7 bits (76), Expect = 0.082 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +3 Query: 267 REREDA-LRRFRT--GQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGR 437 +E +DA L F+ G +LVAT G+D V I+F + E ++ GR GR Sbjct: 212 KENKDAILESFKRLDGHVQVLVATIAFGMGIDCKGVHRTIHFGPSKNCEAFIQETGRAGR 271 >SB_28817| Best HMM Match : DEAD (HMM E-Value=3.4e-32) Length = 651 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 306 QTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGR 437 ++ ++VAT G+D +VR VI+ +E Y GR GR Sbjct: 352 RSQVVVATVAFGMGIDKSNVRFVIHHSFSKSMENYYQESGRAGR 395 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 372 VINFDLPSDVEEYVHRIGRTGRMGNLGVATSF 467 ++N D + E+Y+HR+GRT R G G + +F Sbjct: 119 ILNMDF--EKEDYIHRVGRTARAGRSGRSVTF 148 >SB_1038| Best HMM Match : Helicase_C (HMM E-Value=1.1e-10) Length = 435 Score = 32.7 bits (71), Expect = 0.33 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = +3 Query: 267 REREDA-LRRFRT--GQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGR 437 +E +DA L F+ G +LVAT G+D V ++F + E ++ G GR Sbjct: 243 KENKDAILESFKRLDGHVQVLVATIAFGMGIDCKGVHRTMHFGPSKNCEAFIQETGHAGR 302 Query: 438 MG 443 G Sbjct: 303 DG 304 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 31.5 bits (68), Expect = 0.77 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = -1 Query: 758 RTTR-HSYHHMSPRHSQSRNRYRQLLQNVPPDEVVYGSPLSRSRYRRNEHS-QNESQCAD 585 RTTR ++ H + +Q + ++ ++ V PD + Y SP+S R+N +S N Q D Sbjct: 2655 RTTRDYTVHFHQNKSTQEKGKHFKVSGPVAPDTIRYQSPVSPRTPRKNLNSTHNAKQSPD 2714 Query: 584 R 582 + Sbjct: 2715 Q 2715 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 5.4 Identities = 21/98 (21%), Positives = 44/98 (44%) Frame = +1 Query: 46 VRKYYTEGCLGRRNGQAFLFIGFTKCIKLATTCTSRRGSTYTCVCGN*EGADQLEEYLYS 225 +R+ GC RR +++ GF++ + TT +++ G+ + + ++ Sbjct: 39 LRQLAKGGCAARR--LSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPSSYNGHQFLVFR 96 Query: 226 QGYPVTSIHGTVTNVNVKMLYDVFELDKHQYLWQQLSL 339 +P + H K LY + KHQ+LW++ +L Sbjct: 97 TDFPFSK-HKNRFKRRTKYLYVITTSTKHQHLWRRSAL 133 >SB_32823| Best HMM Match : Late_protein_L1 (HMM E-Value=2.5) Length = 585 Score = 28.7 bits (61), Expect = 5.4 Identities = 28/97 (28%), Positives = 40/97 (41%), Gaps = 3/97 (3%) Frame = +1 Query: 40 LNVRKYYTEGCLGRRN-GQAFLFIGFTKCIKLATTCTSRRGSTYTC-VCGN*EGADQLEE 213 L+ +Y GCL G ++ + L C+SR GSTYTC C A+ Sbjct: 81 LSTNRYPKSGCLANPALGWYVTWLHWGPDKLLTLHCSSRTGSTYTCSTCPTSPPANTCGS 140 Query: 214 YLYSQGYPVTSIHGTVTNVNVKMLYDVF-ELDKHQYL 321 +S + V +V K+L VF L H+ L Sbjct: 141 AAWSTTPSSEYLVELVESVQKKVLRIVFPNLSYHEAL 177 >SB_43422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 650 SPLSRSRYRRNEHSQNESQCADRR 579 +PL RYR+ EH E +C D R Sbjct: 1185 NPLLTFRYRQKEHEDREKRCHDMR 1208 >SB_1215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 390 PSDVEEYVHRIGRTGRMGNLGVATSFFNDTNRGLARDLVD 509 P D+E Y IGR GR G F+ + +R L++ Sbjct: 233 PKDIESYYQEIGRAGRDGEPSSCYVFYKPGDFATSRYLIN 272 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 405 EYVHRIGRTGRMGNLGVATSFFNDTNRGLARDLVDCSSRLNKTY 536 E HR + G FF++T+ GL RD VD + L TY Sbjct: 183 EVTHRFTFSRVFGPETTQKDFFDETSLGLVRDFVDGQNCLVFTY 226 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVA 338 D +Q ER L +F+ + PILVAT VA Sbjct: 762 DMDQFERSKVLGQFKKREIPILVATDVA 789 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 28.3 bits (60), Expect = 7.2 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +3 Query: 348 LDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATS--FF--NDTNRGLAR 497 LD+P VR + D +HR G G +GNL A S F+ + T+RG +R Sbjct: 1633 LDVPMVRQQLRSAEMLDAVR-IHRQGEPGHVGNLDCAFSLKFYSQSSTHRGTSR 1685 >SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) Length = 2119 Score = 27.9 bits (59), Expect = 9.5 Identities = 8/15 (53%), Positives = 15/15 (100%) Frame = +1 Query: 205 LEEYLYSQGYPVTSI 249 LE+Y+Y++GYP++S+ Sbjct: 444 LEQYVYTEGYPISSL 458 >SB_23095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2722 Score = 27.9 bits (59), Expect = 9.5 Identities = 26/88 (29%), Positives = 36/88 (40%), Gaps = 6/88 (6%) Frame = +3 Query: 270 EREDALRRFRTGQTPILVATAVAARGLDIPHVRHVIN----FDLPSDVEEYVHRIGRTGR 437 ER+ FR G +LVAT+ G+++P R +I D Y GR GR Sbjct: 568 ERDIIEGAFRQGTIRVLVATSTLCSGVNLPARRVIIRTPTFHGRMVDPLVYKQMAGRAGR 627 Query: 438 MG--NLGVATSFFNDTNRGLARDLVDCS 515 G LG + + R A L+ S Sbjct: 628 KGVDALGESLLICKTSERAKATTLMKSS 655 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,336,303 Number of Sequences: 59808 Number of extensions: 373081 Number of successful extensions: 1271 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 1180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1262 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -