BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0435 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 111 5e-27 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 7.2 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 111 bits (268), Expect = 5e-27 Identities = 56/94 (59%), Positives = 72/94 (76%), Gaps = 1/94 (1%) Frame = +3 Query: 255 DRNQREREDALRRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTG 434 DR QR+RE+AL F++G+ ILVATAVAARGLDI +V HVIN+DLP ++EYVHRIGRTG Sbjct: 484 DRLQRQREEALADFKSGRMSILVATAVAARGLDIKNVSHVINYDLPKGIDEYVHRIGRTG 543 Query: 435 RMGNLGVATSFFN-DTNRGLARDLVDCSSRLNKT 533 R+GN G ATSFF+ + + L DLV + N++ Sbjct: 544 RVGNRGRATSFFDPEEDAPLRGDLVRILKQANQS 577 Score = 26.2 bits (55), Expect = 0.33 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 2 LYNYVFLAVGRVGSTSENITQKVVWVDEMDKR 97 L NY+FLAVG VG ++ Q V K+ Sbjct: 404 LNNYLFLAVGIVGGACSDVEQNFYEVARNKKK 435 Score = 25.0 bits (52), Expect = 0.77 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 196 ADQLEEYLYSQGYPVTSIHG 255 AD + +L YP TSIHG Sbjct: 464 ADFIAVFLSENNYPTTSIHG 483 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 506 RLLVEAKQDVPNWL 547 R+L +A Q VP+W+ Sbjct: 569 RILKQANQSVPDWM 582 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 556 GASKPIRYVLFSLDEQSTRSRAKPR 482 GAS PI +++ ++QST A PR Sbjct: 55 GASLPIDVDVYNTEQQSTVFVAIPR 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,756 Number of Sequences: 438 Number of extensions: 3517 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -