BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0434 (560 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 4.1 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 22 4.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 5.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.2 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 7.2 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 193 KRINQEIERQLRKDKRDARRASNCSYLELESR 288 K +I ++ RKDKR+ R S S S+ Sbjct: 366 KLCGMKIVKKRRKDKREITRKSTSSSTHTSSQ 397 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 348 DKRGFIKLVYQNIFMAMQSMIRAMDLLTIQY 440 DK GF L + + ++RA D+L + Y Sbjct: 85 DKHGFTILNSMHKYQPRFHLVRANDILKLPY 115 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = +2 Query: 425 TNNTIWEPSNVEKAELISSIDFESVTTFRVRTWKLS 532 +NN SNV S D T + +R W +S Sbjct: 102 SNNNFKTYSNVTTCSYYSLDDLSEDTFYDIRLWGVS 137 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -1 Query: 422 VHGAYHTLHRHEDVLVNEFDE 360 V G TLH H LV F+E Sbjct: 574 VLGRICTLHHHLSKLVTRFNE 594 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -1 Query: 422 VHGAYHTLHRHEDVLVNEFDE 360 V G TLH H LV F+E Sbjct: 218 VLGKICTLHHHLSKLVTRFNE 238 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,533 Number of Sequences: 336 Number of extensions: 2815 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -