BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0434 (560 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 24 1.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 24 1.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 24 1.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 24 1.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 24 1.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 24 1.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 24 1.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 24 1.2 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 1.6 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 1.6 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 1.6 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 1.6 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 2.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 4.9 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 8.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.5 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 107 TGLRARGQIAALRSEKSWSAACQKKQRNKK 196 TGLR+R Q LR + W ++++ +++ Sbjct: 25 TGLRSRTQEERLRRRREWMIQQEREREHER 54 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 107 TGLRARGQIAALRSEKSWSAACQKKQRNKK 196 TGLR+R Q LR + W ++++ +++ Sbjct: 25 TGLRSRTQEERLRRRREWMIQQEREREHER 54 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 107 TGLRARGQIAALRSEKSWSAACQKKQRNKK 196 TGLR+R Q LR + W ++++ +++ Sbjct: 25 TGLRSRTQEERLRRRREWMIQQEREREHER 54 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 107 TGLRARGQIAALRSEKSWSAACQKKQRNKK 196 TGLR+R Q LR + W ++++ +++ Sbjct: 25 TGLRSRTQEERLRRRREWMIQQEREREHER 54 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 107 TGLRARGQIAALRSEKSWSAACQKKQRNKK 196 TGLR+R Q LR + W ++++ +++ Sbjct: 25 TGLRSRTQEERLRRRREWMIQQEREREHER 54 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 107 TGLRARGQIAALRSEKSWSAACQKKQRNKK 196 TGLR+R Q LR + W ++++ +++ Sbjct: 25 TGLRSRTQEERLRRRREWMIQQEREREHER 54 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 107 TGLRARGQIAALRSEKSWSAACQKKQRNKK 196 TGLR+R Q LR + W ++++ +++ Sbjct: 25 TGLRSRTQEERLRRRREWMIQQEREREHER 54 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 107 TGLRARGQIAALRSEKSWSAACQKKQRNKK 196 TGLR+R Q LR + W ++++ +++ Sbjct: 25 TGLRSRTQEERLRRRREWMIQQEREREHER 54 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 199 SFFVPLLLLTCSTP*FFRAEGRNLSSRA 116 SFF+PLLL++ + A R L RA Sbjct: 204 SFFIPLLLMSLVYLEIYLATRRRLRERA 231 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 199 SFFVPLLLLTCSTP*FFRAEGRNLSSRA 116 SFF+PLLL++ + A R L RA Sbjct: 204 SFFIPLLLMSLVYLEIYLATRRRLRERA 231 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 106 PFGRPFNRGTPLPNIYP*GT 47 P+G P G P++YP T Sbjct: 381 PYGYPIGSGGSFPSLYPMAT 400 Score = 21.0 bits (42), Expect = 8.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 45 IVPYGYIFGSG 77 I PYGY GSG Sbjct: 379 ISPYGYPIGSG 389 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 199 SFFVPLLLLTCSTP*FFRAEGRNLSSRA 116 SFF+PLLL++ + A R L RA Sbjct: 204 SFFIPLLLMSLVYLEIYLATRRRLRERA 231 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.0 bits (47), Expect = 2.1 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 560 WM-PESAHKPLIASTYGL*TLSHSQSRSMISIPP 462 W+ PE+A + L TLS ++S S+PP Sbjct: 267 WIKPEAAPARVTLGVTSLLTLSTQHAKSQASLPP 300 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 4.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 52 GTIKCSTSNYCT 17 G ++C+TSNY T Sbjct: 767 GLLQCATSNYST 778 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.0 bits (42), Expect = 8.5 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +1 Query: 121 ERTDCGPPL*KIMECCMSEE--AKEQKRI 201 E + G PL I+E C +E A E+ +I Sbjct: 510 EDLEMGTPLENILESCQQDETHAPEKTKI 538 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 8.5 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 198 DQSRNREATQKGQTRCQKSLKL 263 D+ E +GQ+ +K LKL Sbjct: 283 DEENEEEEDGRGQSEAEKRLKL 304 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,516 Number of Sequences: 438 Number of extensions: 3805 Number of successful extensions: 18 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -