Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e40h0433
         (768 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A2DZN1 Cluster: Putative uncharacterized protein; n=1; ...    33   7.8  

>UniRef50_A2DZN1 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 465

 Score = 33.1 bits (72), Expect = 7.8
 Identities = 21/37 (56%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +3

Query: 651 IVLHNTFSN--LQIGIHYCFTAELGRSVISAQAGLHY 755
           I L N F N  +QI IHYCFTA L   VISA A   Y
Sbjct: 157 IWLINWFINFKVQIYIHYCFTATLSAMVISAIAYTGY 193


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 642,414,980
Number of Sequences: 1657284
Number of extensions: 11893391
Number of successful extensions: 26583
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 24686
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26557
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 64204279620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)