BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0432 (757 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z84574-2|CAB06542.1| 488|Caenorhabditis elegans Hypothetical pr... 28 6.2 Z81514-5|CAB04192.2| 611|Caenorhabditis elegans Hypothetical pr... 28 6.2 >Z84574-2|CAB06542.1| 488|Caenorhabditis elegans Hypothetical protein F33E2.3 protein. Length = 488 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = -1 Query: 736 NNIAISSYNFNNLQVLDHRYYILK-YTFKILMKLHNKTRSKHKIEIFAWRCKLLWLHRSR 560 + + + +N+N L L Y+++ T +I+ + N+ RS + IEI +L WL R R Sbjct: 306 DRVQATYFNYNGLTYLAGICYLMRSITDEIICDI-NRPRSFNHIEICRKAFELTWLERRR 364 >Z81514-5|CAB04192.2| 611|Caenorhabditis elegans Hypothetical protein F26F2.6 protein. Length = 611 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 41 DRMSLSGLVRPLNCLLVRPINGLYC 115 DRM + V+P +C + RP+ G C Sbjct: 583 DRMQIKDEVQPFSCKVPRPLKGYIC 607 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,994,424 Number of Sequences: 27780 Number of extensions: 322266 Number of successful extensions: 592 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -