BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0431 (665 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z35719-8|CAA84801.1| 1521|Caenorhabditis elegans Hypothetical pr... 27 9.1 Z35663-17|CAA84737.1| 1521|Caenorhabditis elegans Hypothetical p... 27 9.1 D14635-1|BAA03484.1| 1521|Caenorhabditis elegans EMB-5 protein. 27 9.1 >Z35719-8|CAA84801.1| 1521|Caenorhabditis elegans Hypothetical protein T04A8.14 protein. Length = 1521 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 522 DARLNDRKCRRKTIFGDELQRSDAHNNTHNVSY 424 D L + ++KT ++R AH N HNVSY Sbjct: 1276 DLELMKSESKKKTEANTRVKRVIAHPNFHNVSY 1308 >Z35663-17|CAA84737.1| 1521|Caenorhabditis elegans Hypothetical protein T04A8.14 protein. Length = 1521 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 522 DARLNDRKCRRKTIFGDELQRSDAHNNTHNVSY 424 D L + ++KT ++R AH N HNVSY Sbjct: 1276 DLELMKSESKKKTEANTRVKRVIAHPNFHNVSY 1308 >D14635-1|BAA03484.1| 1521|Caenorhabditis elegans EMB-5 protein. Length = 1521 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 522 DARLNDRKCRRKTIFGDELQRSDAHNNTHNVSY 424 D L + ++KT ++R AH N HNVSY Sbjct: 1276 DLELMKSESKKKTEANTRVKRVIAHPNFHNVSY 1308 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,079,749 Number of Sequences: 27780 Number of extensions: 238499 Number of successful extensions: 589 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1497472076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -