BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0430 (668 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 25 2.9 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 6.6 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 24.6 bits (51), Expect = 2.9 Identities = 14/57 (24%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +2 Query: 272 STVRRYW-RTSADSNTKIIQKESPPANNNTAAKKPVPKAENPQPSVDLSFFQSPPQN 439 ST RY RT ++ + +PP T++++ P + + + + PPQN Sbjct: 313 STEHRYTTRTPTTTHRLAARTSTPPDPETTSSQQCHPPVNDTLEAPNSTLVSGPPQN 369 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.4 bits (48), Expect = 6.6 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 382 FWYWFFGCSIVVGRWRLFLNYFSVG 308 F YW FG ++ GR L + ++G Sbjct: 90 FTYWLFGYAMAFGRGELNNPFVALG 114 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 720,495 Number of Sequences: 2352 Number of extensions: 15643 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -