BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0429 (728 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U10414-10|AAA19077.1| 176|Caenorhabditis elegans Hypothetical p... 30 1.5 Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical pr... 28 5.9 AC025726-25|AAK73927.2| 409|Caenorhabditis elegans Hypothetical... 28 7.9 >U10414-10|AAA19077.1| 176|Caenorhabditis elegans Hypothetical protein F42A10.6 protein. Length = 176 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 81 WSWHLRVRAWLSTTTVTMQMRISACSSPVP 170 WSW++ W S T + I AC++ VP Sbjct: 88 WSWNMATCGWSSVPTFGLLNNIDACTNGVP 117 >Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical protein C33B4.3a protein. Length = 1110 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 193 EYDEVPDKGTGDEHADIR 140 +YD+ PD GTGD +IR Sbjct: 1017 DYDDDPDSGTGDSDGEIR 1034 >AC025726-25|AAK73927.2| 409|Caenorhabditis elegans Hypothetical protein Y71G12B.26 protein. Length = 409 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 386 IAPLMMANEALAKFLSLISLLP*CWN 309 + P + ++AL FL++++LLP WN Sbjct: 163 VTPSLEISQALCGFLAILTLLPVIWN 188 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,669,035 Number of Sequences: 27780 Number of extensions: 363466 Number of successful extensions: 1058 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -