BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0427 (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53881| Best HMM Match : LSPR (HMM E-Value=1.7) 28 8.9 SB_21135| Best HMM Match : Peroxin-13_N (HMM E-Value=0) 28 8.9 >SB_53881| Best HMM Match : LSPR (HMM E-Value=1.7) Length = 331 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 288 VLCLLV*EFI*QRSFARYQII*IFILLVVKCPC 386 +L LV E+ QRSFA + + +F+LL C C Sbjct: 238 LLTYLVEEYKFQRSFATTEFVCLFLLLFHTCMC 270 >SB_21135| Best HMM Match : Peroxin-13_N (HMM E-Value=0) Length = 383 Score = 27.9 bits (59), Expect = 8.9 Identities = 17/63 (26%), Positives = 31/63 (49%) Frame = +2 Query: 416 SITCVFDAFINLLMNTPFNHFSMFNAFVIIFYKAINY*LCVRLQDSSMNFFKCIVPIIMS 595 S+ + AF ++ M HF+MFN+F + A ++ RL++ ++ F + Sbjct: 126 SVESIVQAFGSIAMMLESTHFAMFNSFRAVIGAADHF---SRLKNHLLSAFGAVAIFRTL 182 Query: 596 KYL 604 KYL Sbjct: 183 KYL 185 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,440,883 Number of Sequences: 59808 Number of extensions: 391546 Number of successful extensions: 551 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -