BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0427 (726 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92967-2|CAB07478.1| 1101|Caenorhabditis elegans Hypothetical pr... 30 1.5 Z82052-10|CAB04830.1| 1101|Caenorhabditis elegans Hypothetical p... 30 1.5 AL021572-4|CAA16519.1| 1101|Caenorhabditis elegans Hypothetical ... 30 1.5 AL021507-1|CAA16430.1| 1101|Caenorhabditis elegans Hypothetical ... 30 1.5 Z82266-12|CAB05185.2| 1080|Caenorhabditis elegans Hypothetical p... 30 1.9 Z92847-3|CAB07422.2| 323|Caenorhabditis elegans Hypothetical pr... 28 7.8 Z68119-6|CAE17916.1| 181|Caenorhabditis elegans Hypothetical pr... 28 7.8 >Z92967-2|CAB07478.1| 1101|Caenorhabditis elegans Hypothetical protein T25E12.4a protein. Length = 1101 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 431 FDAFINLLMNTPFNHFSMFNAFVIIFYKAINY*LCV 538 F F++LL+ PF + +F+ F+I F + + CV Sbjct: 1061 FSYFLHLLVTYPFKFYFVFSCFIIFFPNFLTHIPCV 1096 >Z82052-10|CAB04830.1| 1101|Caenorhabditis elegans Hypothetical protein T25E12.4a protein. Length = 1101 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 431 FDAFINLLMNTPFNHFSMFNAFVIIFYKAINY*LCV 538 F F++LL+ PF + +F+ F+I F + + CV Sbjct: 1061 FSYFLHLLVTYPFKFYFVFSCFIIFFPNFLTHIPCV 1096 >AL021572-4|CAA16519.1| 1101|Caenorhabditis elegans Hypothetical protein T25E12.4a protein. Length = 1101 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 431 FDAFINLLMNTPFNHFSMFNAFVIIFYKAINY*LCV 538 F F++LL+ PF + +F+ F+I F + + CV Sbjct: 1061 FSYFLHLLVTYPFKFYFVFSCFIIFFPNFLTHIPCV 1096 >AL021507-1|CAA16430.1| 1101|Caenorhabditis elegans Hypothetical protein T25E12.4a protein. Length = 1101 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 431 FDAFINLLMNTPFNHFSMFNAFVIIFYKAINY*LCV 538 F F++LL+ PF + +F+ F+I F + + CV Sbjct: 1061 FSYFLHLLVTYPFKFYFVFSCFIIFFPNFLTHIPCV 1096 >Z82266-12|CAB05185.2| 1080|Caenorhabditis elegans Hypothetical protein F23B2.11 protein. Length = 1080 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 458 NTPFNHFSMFNAFVIIFYKAINY 526 NTP N+ FN F+IIFY Y Sbjct: 837 NTPLNNIVAFNQFMIIFYNGGQY 859 >Z92847-3|CAB07422.2| 323|Caenorhabditis elegans Hypothetical protein H01G02.2 protein. Length = 323 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 121 YRHTLKIVRKHFLLEHILVTIRNSIKIFGF 32 Y H+ +I+ + E+ILVT RN +KI F Sbjct: 117 YLHSKEIMHRDIKPENILVTSRNVVKIADF 146 >Z68119-6|CAE17916.1| 181|Caenorhabditis elegans Hypothetical protein T18D3.9 protein. Length = 181 Score = 27.9 bits (59), Expect = 7.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +3 Query: 24 CLMKPKIFIEFLIVTRICSRRKCFLTILRVCL 119 C M P +FI F ++ ++ K L + ++C+ Sbjct: 57 CFMAPSLFIWFRLLEKVKGNNKSLLLVKKLCI 88 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,113,115 Number of Sequences: 27780 Number of extensions: 339043 Number of successful extensions: 673 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -