BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0427 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 3.9 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 6.8 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.0 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.0 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 9.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.0 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 3.9 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -3 Query: 418 RLAKIFLFQLKHGHFTTKSIKIYMI*YLAKLLCYMNS*TNKQSTNILCSGLL 263 R A F F + + TK+ +I I +K S + +S I+CSGL+ Sbjct: 725 RFAAGFCFTVVYAALLTKTNRISRIFNASKHSAKRPSFISPRSQLIICSGLV 776 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 628 PPFLNF*LKTYKMVETDDVP 687 P L F LKT K+V+ ++P Sbjct: 158 PKLLTFDLKTSKLVKQVEIP 177 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 23 MFNETKNLY*ISNSDQNMFKEKMLSNN 103 + E KN +SN+D +++ M +NN Sbjct: 362 IIQEMKNDVLLSNNDVYLYQNTMSNNN 388 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 23 MFNETKNLY*ISNSDQNMFKEKMLSNN 103 + E KN +SN+D +++ M +NN Sbjct: 400 IIQEMKNDVLLSNNDVYLYQNTMSNNN 426 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.4 bits (43), Expect = 9.0 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = -1 Query: 642 IKEWRNFLD 616 +KEWR+F+D Sbjct: 275 VKEWRDFVD 283 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 653 KLTKW*KQMMFLKKLERKWQKL 718 +L +W K M+F+ LER ++L Sbjct: 19 ELLRWTKNMVFVVGLERVAEEL 40 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,105 Number of Sequences: 438 Number of extensions: 4229 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -