BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0426 (537 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-tran... 23 6.5 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 23 8.6 >AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-transferase D10 protein. Length = 211 Score = 23.0 bits (47), Expect = 6.5 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 108 LNSAREQIKSENPGLRVTEIAKKGGEIWKS 197 L REQ++ NP + + G IW+S Sbjct: 35 LPEVREQLRKFNPQHTIPTFIEDGHVIWES 64 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 22.6 bits (46), Expect = 8.6 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 131 YLFPRAV*PQHVCGHRTLRLVRHFDFFPD 45 Y + AV QH + L + FD FPD Sbjct: 124 YQYAMAVAIQHRPDTKNLNIPSFFDLFPD 152 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 441,585 Number of Sequences: 2352 Number of extensions: 6688 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -