BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0423 (774 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC11E10.08 |rik1||silencing protein Rik1|Schizosaccharomyces p... 27 3.9 SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Ma... 27 3.9 SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc... 26 5.2 SPAC4G8.05 |ppk14||serine/threonine protein kinase Ppk14 |Schizo... 26 5.2 SPAC1420.01c ||SPAC56E4.08c|DUF1752 family protein|Schizosacchar... 25 9.1 SPBC1105.14 |rsv2||transcription factor Rsv2|Schizosaccharomyces... 25 9.1 SPCC1494.09c |||sequence orphan|Schizosaccharomyces pombe|chr 3|... 25 9.1 >SPCC11E10.08 |rik1||silencing protein Rik1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1040 Score = 26.6 bits (56), Expect = 3.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 653 CPFFGFFMRINGPCLFFPFW 594 C + G F+ INGPC + W Sbjct: 239 CMYRGNFVTINGPCTTYMHW 258 >SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Manual Length = 918 Score = 26.6 bits (56), Expect = 3.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -1 Query: 591 RSTTDPVLGRTLSSNREALCSRITVPVSIFLGKAGCWHCSLRHYSVVSLVN 439 +S TD L R N+ +LC V + +GCW + +V+ +++ Sbjct: 40 KSFTDGFLLRRAVLNQTSLCENPPADVREWKNSSGCWAPKIFERAVIVIID 90 >SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1463 Score = 26.2 bits (55), Expect = 5.2 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +2 Query: 71 HCSFKFDSFFTKTESHRTLVLKDLHTFIVLRPTLGTVSCLGA*RVNISL 217 H + KFD + + + LVL D+ I + +G V GA + ++L Sbjct: 1221 HGAIKFDHYSVRYRENLPLVLNDISVNIKPQEKIGIVGRTGAGKSTLTL 1269 >SPAC4G8.05 |ppk14||serine/threonine protein kinase Ppk14 |Schizosaccharomyces pombe|chr 1|||Manual Length = 566 Score = 26.2 bits (55), Expect = 5.2 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +3 Query: 234 SINSI-QNVAQKITCPSRSDDIGTQYTNPNTKRHGFFAN 347 SI+S+ +N+ +K+ +D +G+Q + K H FF N Sbjct: 449 SISSLCKNLIRKLLVKDENDRLGSQAGAADVKLHPFFKN 487 >SPAC1420.01c ||SPAC56E4.08c|DUF1752 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 25.4 bits (53), Expect = 9.1 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +3 Query: 243 SIQNVAQKITCPSRSDDIGTQYTNPNTKRHGFFANESQDSKHFESS 380 S +NV+ + S DD Q PN + F+ S D+ H SS Sbjct: 322 STKNVSHEEKSHSVQDDKSKQLLKPNPTQPYFYLRGSFDTGHSASS 367 >SPBC1105.14 |rsv2||transcription factor Rsv2|Schizosaccharomyces pombe|chr 2|||Manual Length = 637 Score = 25.4 bits (53), Expect = 9.1 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 400 PEKNQQANGLTGVIHQGNNGVMPQGTVPTAS 492 P Q +TG G NG P T PT S Sbjct: 519 PNPTNQKVSITGAAADGPNGSAPVDTTPTNS 549 >SPCC1494.09c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 157 Score = 25.4 bits (53), Expect = 9.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 401 GFKRSRSTTFKMFRVLRLVCEKTMSFG 321 GF S TTFK+F +L +C + + G Sbjct: 83 GFPASPETTFKVFSLLDSLCLRLIQSG 109 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,202,762 Number of Sequences: 5004 Number of extensions: 68069 Number of successful extensions: 224 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 224 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 373338084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -