BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0423 (774 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.8 AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin prepr... 21 9.6 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 21 9.6 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.8 bits (49), Expect = 1.8 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +1 Query: 235 QSILYKMLLKRSPARV--GATISELNTPIQTPKDMVFSQTSLKTRNILKVVD 384 Q + K +LKRS GA+ + PK+ V + LK+ + KVVD Sbjct: 3 QPNICKQILKRSAESEFEGASSPKKRNKNPQPKNAVCALNELKSGAVYKVVD 54 >AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin preprohormone protein. Length = 107 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/35 (28%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 537 MLHGS-NSEFFQELDQLCSDPEREEQTRTIDSHKE 638 +L G+ N++ FQ +L + P+R I+ H++ Sbjct: 65 LLQGNINNQLFQTPCELLNFPKRSFSENMINDHRQ 99 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 144 IHSLYSGLLSGQLVV 188 I+ LY GLLSG +++ Sbjct: 126 IYHLYMGLLSGGIIL 140 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,388 Number of Sequences: 438 Number of extensions: 4082 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -