BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0420 (459 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 26 0.73 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 22 9.0 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 25.8 bits (54), Expect = 0.73 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 326 ECCDGVCGVTRMDRIRXEYVRGSLKVATEKLRSA--RLEWYGHVMK 457 EC + + G+ + + Y + SLK ++L A L+ Y HV K Sbjct: 938 ECTEKIAGLGALPNVDASYQKMSLKSLFKELEKANQHLKKYNHVNK 983 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 22.2 bits (45), Expect = 9.0 Identities = 7/29 (24%), Positives = 18/29 (62%) Frame = +2 Query: 332 CDGVCGVTRMDRIRXEYVRGSLKVATEKL 418 C G+ +TRM ++ E ++ +++ T ++ Sbjct: 224 CPGLLKLTRMTSLQPELIKFVMEIITHQI 252 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 457,167 Number of Sequences: 2352 Number of extensions: 8515 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -