BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0417 (765 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 25 0.88 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 4.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 6.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.2 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 24.6 bits (51), Expect = 0.88 Identities = 11/35 (31%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 46 FEPLQNITHYITLFFEVRNILSS-LFNPISLILRS 147 F Q++ HY+ +FF V N++ L + + L+L++ Sbjct: 516 FNNYQSLAHYLRVFFTVFNVVHCYLASELVLMLKN 550 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = -1 Query: 426 SQRKKLHLHILFRLYLNVDLLTDKYYTC 343 S K + LH+++ +L + D +Y C Sbjct: 986 SSEKIVWLHLVYISFLGIICAADVFYIC 1013 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 735 KLYRKKLSSLWHS 697 K R KL S+WHS Sbjct: 163 KKIRSKLGSIWHS 175 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 98 VIFFHLCLIQYLLFF 142 VI FHL L LL+F Sbjct: 45 VIIFHLILFAVLLYF 59 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 485 VTVTKCGIFFVETLICLFL 541 V+V KC +FFV L L + Sbjct: 302 VSVWKCLLFFVSVLFILLV 320 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 485 VTVTKCGIFFVETLICLFL 541 V+V KC +FFV L L + Sbjct: 302 VSVWKCLLFFVSVLFILLV 320 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 485 VTVTKCGIFFVETLICLFL 541 V+V KC +FFV L L + Sbjct: 302 VSVWKCLLFFVSVLFILLV 320 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 485 VTVTKCGIFFVETLICLFL 541 V+V KC +FFV L L + Sbjct: 302 VSVWKCLLFFVSVLFILLV 320 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,555 Number of Sequences: 336 Number of extensions: 3654 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -