BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0417 (765 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 5.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 5.4 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 22 5.4 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 7.2 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 7.2 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/41 (21%), Positives = 18/41 (43%) Frame = -1 Query: 495 VTVTFSFSYETNLTIKTIPNEI*SQRKKLHLHILFRLYLNV 373 V F YE+N+ + +P+ + L + F +Y + Sbjct: 384 VRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIYKTI 424 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/41 (21%), Positives = 18/41 (43%) Frame = -1 Query: 495 VTVTFSFSYETNLTIKTIPNEI*SQRKKLHLHILFRLYLNV 373 V F YE+N+ + +P+ + L + F +Y + Sbjct: 384 VRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIYKTI 424 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/41 (21%), Positives = 18/41 (43%) Frame = -1 Query: 495 VTVTFSFSYETNLTIKTIPNEI*SQRKKLHLHILFRLYLNV 373 V F YE+N+ + +P+ + L + F +Y + Sbjct: 10 VRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIYKTI 50 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 7.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 636 TVKGKYNKLFFSKKNIIVTYKLKRKIAY*ISTKNKQIKV 520 TVK K N ++ S ++ KLK IS + ++KV Sbjct: 238 TVKKKVNYVYRSVDQVLEDGKLKPNKKVRISNEMSKVKV 276 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 371 STFKYNLNNICK 406 + +KYN NN CK Sbjct: 94 NNYKYNYNNNCK 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,215 Number of Sequences: 438 Number of extensions: 3656 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -