BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0413 (728 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 6.8 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 9.0 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/45 (24%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -3 Query: 213 IVRNLIPQHMLVTC-RTIVRTFPIERTARNSPHTPTIIVLLLIVY 82 I+RN++P++++ C + T+ + A + T I +VY Sbjct: 190 IIRNMVPENLVQACFQQAQTTYVTKEVATGTASEITQIQEATLVY 234 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 83 YTINNKTIIVGVCGELRAVLSIGNVLTMV 169 YT+ +I V G + IGN+L V Sbjct: 36 YTVTQAILIALVLGSIIVGTVIGNILVCV 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,085 Number of Sequences: 438 Number of extensions: 5769 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -