BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0411 (762 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1773.15 |||membrane transporter|Schizosaccharomyces pombe|ch... 27 2.2 SPAC10F6.05c |ubc6||ubiquitin conjugating enzyme Ubc6|Schizosacc... 25 8.9 >SPBC1773.15 |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 497 Score = 27.5 bits (58), Expect = 2.2 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -3 Query: 586 NETTLNEFSLDYIITMIVRITNGVFVY 506 N T++ + + +IIT ++ I NGVF++ Sbjct: 206 NNLTMSPWRILFIITGLITIINGVFIF 232 >SPAC10F6.05c |ubc6||ubiquitin conjugating enzyme Ubc6|Schizosaccharomyces pombe|chr 1|||Manual Length = 227 Score = 25.4 bits (53), Expect = 8.9 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 601 IRAITPNSRFRCYLRHLLMYFCFF-NSWNKQDSDGWILIYLYLHISS 738 IR ITP+ RF+ R L + F SWN IL+ L ++S Sbjct: 71 IRMITPSGRFQTNTRLCLSFSDFHPKSWNPSWMVSTILVGLVSFMTS 117 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,498,095 Number of Sequences: 5004 Number of extensions: 43911 Number of successful extensions: 78 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -