BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0409 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 24 1.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 2.0 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 22 4.6 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 8.0 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 323 MIFTNN*KSFCNPILQLDKKCV 388 +I TNN +C ++ L K CV Sbjct: 238 IILTNNQAKYCTTLIGLIKNCV 259 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 601 LRYLSMNNYLSCLHHLNVISCIF 669 LR NNY S H+L V +F Sbjct: 511 LRVQRFNNYQSLAHYLRVFFTVF 533 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 247 NRRYELLE-STLDELNSALDFLERKNDDIHQQLKELLQ 357 NR+ +L+ +EL +DF R H++L E+L+ Sbjct: 83 NRKNRVLQWREPEELRRLMDFGVRSAPSTHEELLEVLK 120 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 663 HIYVNRNEQ*HLVEHCSQKKNGS 731 H+ V+ E+ + EHCS K + S Sbjct: 209 HLRVHTGERPYGCEHCSMKFSDS 231 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,463 Number of Sequences: 336 Number of extensions: 3323 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -