BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0409 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23683| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30353| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_35717| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 32 0.57 SB_12715| Best HMM Match : Adeno_E1A (HMM E-Value=1.3) 31 1.00 SB_23024| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 30 2.3 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_45474| Best HMM Match : PilO (HMM E-Value=1.9) 29 4.0 SB_43555| Best HMM Match : Shugoshin_N (HMM E-Value=2.7) 29 4.0 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 29 4.0 SB_23221| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_56379| Best HMM Match : Shugoshin_N (HMM E-Value=2.7) 29 4.0 SB_56085| Best HMM Match : Shugoshin_N (HMM E-Value=2.7) 29 4.0 SB_53647| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_50205| Best HMM Match : Shugoshin_N (HMM E-Value=2.7) 29 4.0 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 29 4.0 SB_37800| Best HMM Match : Shugoshin_N (HMM E-Value=2.7) 29 4.0 SB_32928| Best HMM Match : PilO (HMM E-Value=1.9) 29 4.0 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_20610| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) 29 5.3 SB_24885| Best HMM Match : HOOK (HMM E-Value=0.00023) 29 5.3 SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 29 5.3 SB_7565| Best HMM Match : Shugoshin_N (HMM E-Value=1.3) 28 7.0 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 28 7.0 SB_54674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_54524| Best HMM Match : Shugoshin_N (HMM E-Value=1.3) 28 7.0 SB_54477| Best HMM Match : Shugoshin_N (HMM E-Value=1.3) 28 7.0 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 28 7.0 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) 28 7.0 >SB_23683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 412 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/51 (35%), Positives = 30/51 (58%) Frame = +1 Query: 256 YELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVN 408 YE L+ LD+LN+ LD LE ND ++ +++E L+ RQ E +++ Sbjct: 30 YEALDDKLDQLNTCLDKLENWNDSLNSRMREFLEDMQKSRQSQTGEANDLD 80 >SB_30353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1553 Score = 36.7 bits (81), Expect = 0.020 Identities = 19/56 (33%), Positives = 31/56 (55%) Frame = +1 Query: 247 NRRYELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNNS 414 N R L+ES L+ N++L K D +QL+++ Q I QE++E E+N + Sbjct: 804 NERVALVESKLNRTNTSLKDTSIKVSDYERQLEKVKQEKQEITQELQETKDELNTT 859 >SB_35717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 32.3 bits (70), Expect = 0.43 Identities = 21/81 (25%), Positives = 37/81 (45%) Frame = -1 Query: 534 MVILRLTISFYTFETNKLH*VTCIFAQLNLK*CCICISSITVVDFLIFFTHFLSNCNIGL 355 +V L + ++ NK H V + QLN I + ++T+ L F T + +C + Sbjct: 65 IVTLNGLLRYFVARENKYHSVQPLSCQLNQCKLLIAVRTVTLYGLLPFCTSTIVDCRENI 124 Query: 354 QKLFQLLVNIIIFTLQEIQCR 292 L L++I T +QC+ Sbjct: 125 NSLLATLLDITRTT--TVQCQ 143 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 31.9 bits (69), Expect = 0.57 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 262 LLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEV 405 LLES L E +D LERK+ ++ ++L + + + + E +E+ Sbjct: 2159 LLESALGEYQDHIDMLERKSKELEEELNTKSEKEVEMLSRVNELQEEL 2206 >SB_12715| Best HMM Match : Adeno_E1A (HMM E-Value=1.3) Length = 909 Score = 31.1 bits (67), Expect = 1.00 Identities = 22/68 (32%), Positives = 31/68 (45%) Frame = -3 Query: 439 VLYLHFFNYCC*LPYFLHAFLV*LQYWIAKALSIVGEYHHFYAPRNPMQN*VHLM*ILII 260 VL L FF PY+L FL A L+ + ++ PR P + + I +I Sbjct: 734 VLVLVFF--AAKFPYWLFLFL---SLHCALVLAFISKHKLGLFPRQPWKQRFTRLVIALI 788 Query: 259 HTFCYIFI 236 HTFC F+ Sbjct: 789 HTFCIFFV 796 >SB_23024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/57 (26%), Positives = 30/57 (52%) Frame = +1 Query: 262 LLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNNSN*RNAN 432 +L S ++ L + L+F + K D + LK Q ++ QE++ N++++ N N Sbjct: 308 ILRSEVETLRAELEFNQHKTDQYEELLKSERQRIRSLEQELQSTNEKLHFQTETNMN 364 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +1 Query: 280 DELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNNS 414 ++L +A+ L++ ND ++Q LKE L + + + E NKE+N S Sbjct: 385 EKLGAAMRDLDKANDHVNQ-LKEKLGAVMRDLDKANERNKELNES 428 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +1 Query: 268 ESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEV 405 E+ LD+L + D+LE +N+ + L SN ++ + + KE+ Sbjct: 556 EALLDKLRATKDYLEEQNESLKASLDAARDSNDLLKADQSKLLKEI 601 >SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/47 (27%), Positives = 30/47 (63%), Gaps = 2/47 (4%) Frame = -3 Query: 364 YWIAKALSIVGEYHHFYAPRNPMQN*VH--LM*ILIIHTFCYIFIVI 230 ++++ L+I+GE+ +PR ++ V M +I+ ++CYIF+++ Sbjct: 145 WFLSIFLTIIGEFPEVSSPRGMIEFSVFSLSMTAIIVVSYCYIFVIV 191 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/49 (30%), Positives = 30/49 (61%), Gaps = 4/49 (8%) Frame = +1 Query: 265 LESTLDELNSALDFLERKNDDIHQQLKELL----QSNIAIRQEMREENK 399 L+ T+DEL++++ + K I +QLK+ L + A+++E+ E+ K Sbjct: 846 LKKTVDELSNSITLRDEKITKIKEQLKQTLEKFKEKEKALKEEIAEKEK 894 >SB_45474| Best HMM Match : PilO (HMM E-Value=1.9) Length = 228 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ELL+ L L ++LDFL K D I LK++ + ++ E+ +EN +++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVK-ELSKENSRLHS 56 >SB_43555| Best HMM Match : Shugoshin_N (HMM E-Value=2.7) Length = 99 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ELL+ L L ++LDFL K D I LK++ + ++ E+ +EN +++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVK-ELSKENSRLHS 56 >SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) Length = 1312 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = +1 Query: 265 LESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNNSN*RNANTAL 441 L +D L ++L+ ++RKN ++ LL+ I REE + S+ + NT L Sbjct: 229 LTRDVDHLTTSLEEVQRKNRKYADEVDRLLKKIQNIEDSFREEKAVLIKSHESDKNTVL 287 >SB_23221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ELL+ L L ++LDFL K D I LK++ + ++ E+ +EN +++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVK-ELSKENSRLHS 56 >SB_56379| Best HMM Match : Shugoshin_N (HMM E-Value=2.7) Length = 109 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ELL+ L L ++LDFL K D I LK++ + ++ E+ +EN +++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVK-ELSKENSRLHS 56 >SB_56085| Best HMM Match : Shugoshin_N (HMM E-Value=2.7) Length = 116 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ELL+ L L ++LDFL K D I LK++ + ++ E+ +EN +++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVK-ELSKENSRLHS 56 >SB_53647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 267 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ELL+ L L ++LDFL K D I LK++ + ++ E+ +EN +++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVK-ELSKENSRLHS 56 >SB_50205| Best HMM Match : Shugoshin_N (HMM E-Value=2.7) Length = 91 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ELL+ L L ++LDFL K D I LK++ + ++ E+ +EN +++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVK-ELSKENSRLHS 56 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +1 Query: 268 ESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENK 399 E + EL L L ++ D+ H Q + + + +E+RE+ K Sbjct: 1022 ERQIKELQEILGTLRKELDEAHNQARSACANELVAMEELREQTK 1065 >SB_37800| Best HMM Match : Shugoshin_N (HMM E-Value=2.7) Length = 109 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ELL+ L L ++LDFL K D I LK++ + ++ E+ +EN +++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVK-ELSKENSRLHS 56 >SB_32928| Best HMM Match : PilO (HMM E-Value=1.9) Length = 228 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ELL+ L L ++LDFL K D I LK++ + ++ E+ +EN +++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVK-ELSKENSRLHS 56 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/54 (29%), Positives = 31/54 (57%) Frame = +1 Query: 280 DELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNNSN*RNANTAL 441 D L + ++++D+I +++KE L+S ++ QE +EE + + N N T L Sbjct: 2658 DHLTNFKQSCQKQSDEI-RRIKEDLKSKESLLQETKEELEALKEENSENKETIL 2710 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/52 (26%), Positives = 28/52 (53%) Frame = +1 Query: 277 LDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNNSN*RNAN 432 L++++ L L K DD+ ++ +E+ R+E+R+E E+ N+ N Sbjct: 2810 LEKMDDNLTELRLKYDDLVKEREEVKSDLATTREELRQEQIELKNARKEGEN 2861 >SB_20610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ELL+ L L ++LDFL K D I LK++ + ++ E+ +EN +++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVK-ELSKENSRLHS 56 >SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) Length = 207 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = +1 Query: 256 YELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMR 387 YE + ++EL ++ L+ +NDD Q+ K L Q ++ R++M+ Sbjct: 133 YESQKIKIEELEVRIEDLKEENDDYQQETKYLKQV-LSYREDMK 175 >SB_24885| Best HMM Match : HOOK (HMM E-Value=0.00023) Length = 873 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/48 (27%), Positives = 32/48 (66%) Frame = +1 Query: 265 LESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKEVN 408 + +T +++ + +E KN + Q+L++ L SN + +++R+ENK+++ Sbjct: 198 ISATKEKIRLLTEEIEEKNV-VMQELRDELISNKKLVEKLRQENKQLS 244 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = +1 Query: 256 YELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMR 387 YE + ++EL ++ L+ +NDD Q+ K L Q ++ R++M+ Sbjct: 870 YESQKIKIEELEVRIEDLKEENDDYQQETKYLKQV-LSYREDMK 912 >SB_7565| Best HMM Match : Shugoshin_N (HMM E-Value=1.3) Length = 267 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENK 399 ELL+ L L ++LDFL K D I LK++ + +++ +E ++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVKELSKENSR 53 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +1 Query: 244 YNRRYELLESTLDELNSALDFLERKNDDIHQQLKEL---LQSNIAIRQEMREENKEVN 408 YN+ E + T+++L D LER+ D + + ++ + ++ I + M + N+ VN Sbjct: 1476 YNQEIESRDKTIEDLKLKRDELERQMDALKKDMRRVEADYETAIQKIENMEKANRSVN 1533 >SB_54674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 310 ERKNDDIHQQLKELLQSNIAIRQEMREENKEVNN 411 ER D QQL +L Q ++ +REE + +N Sbjct: 505 ERMRQDYEQQLSDLKQEVFSLTARLREEEQNADN 538 >SB_54524| Best HMM Match : Shugoshin_N (HMM E-Value=1.3) Length = 259 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENK 399 ELL+ L L ++LDFL K D I LK++ + +++ +E ++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVKELSKENSR 53 >SB_54477| Best HMM Match : Shugoshin_N (HMM E-Value=1.3) Length = 267 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 259 ELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENK 399 ELL+ L L ++LDFL K D I LK++ + +++ +E ++ Sbjct: 10 ELLDKKLAPLQASLDFLNEKYDII---LKKVSDQEVKVKELSKENSR 53 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = +1 Query: 250 RRYELLESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKE 402 R+ ++ES L ++L E + +D+ + LKELL+ + ++EM E E Sbjct: 197 RKESVMESELLRQKASL---ENEKEDLERSLKELLEKSPKEKEEMLSEELE 244 >SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3259 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +1 Query: 268 ESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKE 402 E L+E+ LD +K + I ++ K+L + ++ +E+R NK+ Sbjct: 2304 EEQLEEMQFLLDKKSKKLERITKESKDLKEKVTSLEEELRLSNKQ 2348 >SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 1997 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/45 (31%), Positives = 29/45 (64%) Frame = +1 Query: 265 LESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENK 399 LESTLDE+N L+ ++ ++ +++K L+ ++ + Q+ EE + Sbjct: 1018 LESTLDEVNLNLEREKKVRGEV-EKVKRKLEGDLKMTQQTLEETQ 1061 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,076,426 Number of Sequences: 59808 Number of extensions: 336500 Number of successful extensions: 964 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -