BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0408 (679 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.20 |ubc1||ubiquitin conjugating enzyme Ubc1|Schizosacch... 29 0.62 SPBC543.09 |||mitochondrial m-AAA protease|Schizosaccharomyces p... 27 2.5 SPAC1002.03c |gls2||glucosidase II Gls2|Schizosaccharomyces pomb... 25 7.6 >SPBC2D10.20 |ubc1||ubiquitin conjugating enzyme Ubc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 217 Score = 29.1 bits (62), Expect = 0.62 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +1 Query: 34 GAICMELLTKQGWSSAYTVEAVIMQIAATL 123 GAIC+++L Q WS YT+++ ++ + + L Sbjct: 86 GAICLDILKDQ-WSPVYTMKSALISLQSLL 114 >SPBC543.09 |||mitochondrial m-AAA protease|Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 27.1 bits (57), Expect = 2.5 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 487 APHLIQN-ITTYNNTRTILAKRPFIFSTYIKTSRAYRQT 374 A L+Q + TYN TIL RP+ + ++ S RQ+ Sbjct: 714 AQRLLQKEVITYNEVETILGPRPYAYK-HLNISELMRQS 751 >SPAC1002.03c |gls2||glucosidase II Gls2|Schizosaccharomyces pombe|chr 1|||Manual Length = 923 Score = 25.4 bits (53), Expect = 7.6 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -2 Query: 399 KRVAHT--DRQTLWKC*RAVSYHSY*HGSYVGRNKSLHSAPQFQLPILFRSVN 247 K V H D+ T++ V + + H Y G+ + AP ++P+L R N Sbjct: 738 KPVTHPSIDKITIYLADDEVYFDLHDHTEYAGKGHQVVPAPLGRVPVLLRGGN 790 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,809,375 Number of Sequences: 5004 Number of extensions: 58973 Number of successful extensions: 154 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -