BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0406 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 3.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.0 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 22.6 bits (46), Expect = 3.9 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +2 Query: 548 KDIELQNHVDHRESTEEN-VIKNVRSD-TEMTKDEVG 652 KDI +++VD E +EN +I +SD + M D+ G Sbjct: 410 KDILHEHNVDDNEDHDENMIIPPKKSDMSNMQSDDGG 446 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = -3 Query: 715 CIISCVSFLTFILILA 668 C++SC + + +I+ILA Sbjct: 105 CVLSCWTNIYYIIILA 120 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = -3 Query: 715 CIISCVSFLTFILILA 668 C++SC + + +I+ILA Sbjct: 158 CVLSCWTNIYYIIILA 173 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,524 Number of Sequences: 438 Number of extensions: 3323 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -