BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= e40h0403
(587 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr 1|||M... 25 8.2
>SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr
1|||Manual
Length = 1115
Score = 25.0 bits (52), Expect = 8.2
Identities = 10/31 (32%), Positives = 17/31 (54%)
Frame = +3
Query: 444 NTVSRTLNLPYFKTNVFSVWKLRHLVADASK 536
N ++ LPY+K + S W ++L+ D K
Sbjct: 356 NDPLNSIGLPYYKDELLSSWS-KYLIFDVGK 385
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,101,087
Number of Sequences: 5004
Number of extensions: 36827
Number of successful extensions: 66
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 66
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 66
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 254167452
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -