BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0403 (587 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g33080.2 68414.m04081 MATE efflux family protein similar to r... 29 3.0 At1g33080.1 68414.m04082 MATE efflux family protein similar to r... 29 3.0 >At1g33080.2 68414.m04081 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 490 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -1 Query: 479 KVWQV*GPAYCVRSAHPNIAKLVVTYSGN*KKKTICSYGATLIVSLSFHFNIL 321 K+W V GPA R + ++ + + G+ + +Y TL V L F IL Sbjct: 39 KLWVVAGPAIFTRFSTSGLSLISQAFIGHLGSTELAAYSITLTVLLRFSNGIL 91 >At1g33080.1 68414.m04082 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 494 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -1 Query: 479 KVWQV*GPAYCVRSAHPNIAKLVVTYSGN*KKKTICSYGATLIVSLSFHFNIL 321 K+W V GPA R + ++ + + G+ + +Y TL V L F IL Sbjct: 39 KLWVVAGPAIFTRFSTSGLSLISQAFIGHLGSTELAAYSITLTVLLRFSNGIL 91 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,676,800 Number of Sequences: 28952 Number of extensions: 184342 Number of successful extensions: 279 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 279 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -