BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0402 (695 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1170 - 10002650-10004122 29 2.7 02_05_0825 - 32042128-32042238,32042905-32043246,32043548-32043727 29 4.7 >06_01_1170 - 10002650-10004122 Length = 490 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = +3 Query: 87 VLPIFRERNENDYDVLNRPLPGGPQTGWDRVKAMYKK-NEFDEVSPELHTVVQSTLCVHL 263 V+P + N+++ V +PG P W ++ MY+ E DEVS + + L + Sbjct: 170 VMPRREDENDDESPVGFPDIPGSPAFPWRQMSRMYRAYKEGDEVSDAV--MSNFLLNLQS 227 Query: 264 LVFVSEDLSHLEK 302 FVS LE+ Sbjct: 228 SSFVSNTFGQLER 240 >02_05_0825 - 32042128-32042238,32042905-32043246,32043548-32043727 Length = 210 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 293 MRQILRNKHQQMHAQCGLHNCMQFRR-NFVEFVFF 192 ++ +LR Q +H QCGL +C R + + VFF Sbjct: 173 VQNVLRKCEQLLHQQCGLSSCCNQRHLSHLRSVFF 207 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,208,098 Number of Sequences: 37544 Number of extensions: 335830 Number of successful extensions: 912 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 912 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -