BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0402 (695 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 27 0.75 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 7.0 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 7.0 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 7.0 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 7.0 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 26.6 bits (56), Expect = 0.75 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -1 Query: 437 KDTKHLSQHLYFKNNHVLCKPFTIPLH 357 ++++H+ QH ++ NN FT LH Sbjct: 3268 EESRHILQHKFYSNNSQSLNNFTFGLH 3294 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.4 bits (48), Expect = 7.0 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 248 IVRAFVGVCFGGFVSSREAYLYFIENNQATAYKTVG 355 I+RAFVG F F + YF E +Q T G Sbjct: 515 IIRAFVGPKFDRFFDLQFYKKYFFEIDQYLVDFTAG 550 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 7.0 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 248 IVRAFVGVCFGGFVSSREAYLYFIENNQATAYKTVG 355 I+RAFVG F F + YF E +Q T G Sbjct: 515 IIRAFVGPKFDRFFDLQFYKKYFFEIDQYLVDFTAG 550 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 7.0 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 248 IVRAFVGVCFGGFVSSREAYLYFIENNQATAYKTVG 355 I+RAFVG F F + YF E +Q T G Sbjct: 515 IIRAFVGPKFDRFFDLQFYKKYFFEIDQYLVDFTAG 550 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 7.0 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 248 IVRAFVGVCFGGFVSSREAYLYFIENNQATAYKTVG 355 I+RAFVG F F + YF E +Q T G Sbjct: 515 IIRAFVGPKFDRFFDLQFYKKYFFEIDQYLVDFTAG 550 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,319 Number of Sequences: 2352 Number of extensions: 14791 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -