BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0400 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 27 0.12 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 3.3 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 7.7 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 21 7.7 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 21 7.7 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 7.7 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 27.5 bits (58), Expect = 0.12 Identities = 14/47 (29%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 317 ITSSYYRGAHGIIIVYDCTDQDSF---SNVKQWLEEIDRYACDNVNK 448 + YYR HG + C F SN+ W E DR C + + Sbjct: 487 LCDKYYRCVHGKPTEFACRPGTVFHTQSNICDWPEHADREKCKKIEQ 533 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 192 DTYTESYISTIGVDFKIRTVD 254 D +T S IST G DF VD Sbjct: 299 DNHTLSVISTDGSDFNATEVD 319 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -1 Query: 569 FVEFFADVSRNGMPS 525 FV+F+ + +RNG P+ Sbjct: 452 FVKFWTNFARNGSPN 466 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -1 Query: 569 FVEFFADVSRNGMPS 525 FV+F+ + +RNG P+ Sbjct: 454 FVKFWTNFARNGSPN 468 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -1 Query: 569 FVEFFADVSRNGMPS 525 FV+F+ + +RNG P+ Sbjct: 452 FVKFWTNFARNGSPN 466 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -1 Query: 569 FVEFFADVSRNGMPS 525 FV+F+ + +RNG P+ Sbjct: 454 FVKFWTNFARNGSPN 468 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,605 Number of Sequences: 336 Number of extensions: 2948 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -