BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0399 (679 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 3.0 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 5.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.3 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 9.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 9.3 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 511 YLYYHSVKLFILENKTRNFNIVIFNQI 591 Y Y+ V + I K RN N+++ Q+ Sbjct: 158 YTYFLCVIVCIFRGKYRNINLLLTEQL 184 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.8 bits (44), Expect = 5.3 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 334 GKLDALIQFWVIFGYSCSENKTREFFVLLYLIQFIN 441 G LD+LI V+ KT+E+ L Q+I+ Sbjct: 81 GSLDSLILLMVLVSIILGSLKTKEWAKLNNKFQYID 116 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 9.3 Identities = 12/46 (26%), Positives = 20/46 (43%) Frame = +1 Query: 289 PVFIYTLGVGQTRPCGKLDALIQFWVIFGYSCSENKTREFFVLLYL 426 PV + + VG + + F G S E KTR +F+ ++ Sbjct: 14 PVSVILISVGWWENFVSETSYLPFIRALGKSKKEFKTRTYFIYAFV 59 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.3 Identities = 12/46 (26%), Positives = 20/46 (43%) Frame = +1 Query: 289 PVFIYTLGVGQTRPCGKLDALIQFWVIFGYSCSENKTREFFVLLYL 426 PV + + VG + + F G S E KTR +F+ ++ Sbjct: 247 PVSVILISVGWWENFVSETSYLPFIRALGKSKKEFKTRTYFIYAFV 292 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 9.3 Identities = 12/46 (26%), Positives = 20/46 (43%) Frame = +1 Query: 289 PVFIYTLGVGQTRPCGKLDALIQFWVIFGYSCSENKTREFFVLLYL 426 PV + + VG + + F G S E KTR +F+ ++ Sbjct: 247 PVSVILISVGWWENFVSETSYLPFIRALGKSKKEFKTRTYFIYAFV 292 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.0 bits (42), Expect = 9.3 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = -2 Query: 198 NQPKLQSWS*VDRASAPKGGRAALPAAPEIIQNQTRWGERRSPLSVNNA 52 +QP + +S D+ GR A +PE + R E P + N A Sbjct: 277 HQPSSEVYSMFDKLLLMSEGRTAFLGSPEEAETFFRELEAPCPRNYNPA 325 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 9.3 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = -2 Query: 198 NQPKLQSWS*VDRASAPKGGRAALPAAPEIIQNQTRWGERRSPLSVNNA 52 +QP + +S D+ GR A +PE + R E P + N A Sbjct: 277 HQPSSEVYSMFDKLLLMSEGRTAFLGSPEEAETFFRELEAPCPRNYNPA 325 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,060 Number of Sequences: 336 Number of extensions: 4383 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -