BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0398 (674 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g34358.1 68418.m04025 hypothetical protein 32 0.40 At3g03770.1 68416.m00383 leucine-rich repeat transmembrane prote... 31 0.53 At3g60630.1 68416.m06784 scarecrow transcription factor family p... 31 0.70 At3g14830.1 68416.m01873 expressed protein 29 2.1 At5g58300.1 68418.m07298 leucine-rich repeat transmembrane prote... 29 3.8 At1g77480.2 68414.m09023 nucellin protein, putative similar to n... 29 3.8 At1g77480.1 68414.m09022 nucellin protein, putative similar to n... 29 3.8 At1g23190.1 68414.m02897 phosphoglucomutase, cytoplasmic, putati... 29 3.8 At5g62570.1 68418.m07852 calmodulin-binding protein similar to c... 28 5.0 At2g23230.1 68415.m02774 terpene synthase/cyclase family protein 28 5.0 At1g20550.1 68414.m02561 expressed protein contains Pfam PF03138... 28 5.0 At5g18350.1 68418.m02159 disease resistance protein (TIR-NBS-LRR... 28 6.6 At5g67290.1 68418.m08484 FAD-dependent oxidoreductase family pro... 27 8.7 At5g63710.1 68418.m07997 leucine-rich repeat transmembrane prote... 27 8.7 At5g38560.1 68418.m04662 protein kinase family protein contains ... 27 8.7 >At5g34358.1 68418.m04025 hypothetical protein Length = 116 Score = 31.9 bits (69), Expect = 0.40 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -1 Query: 659 VASLIRDIQSKCGSPTPSPGIHRPPSTSST 570 +A+ I+D QSK P+P P + R STSST Sbjct: 1 MAAQIKDFQSKPRPPSPIPKVRRSGSTSST 30 >At3g03770.1 68416.m00383 leucine-rich repeat transmembrane protein kinase, putative may contain C-terminal ser/thr protein kinase domain, similar to serine/threonine protein kinase Pto GB:AAB47421 [Lycopersicon esculentum] Length = 802 Score = 31.5 bits (68), Expect = 0.53 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +3 Query: 21 ILQLKKNMLGGCLKGGIDKCNLYRVAGVLNRRFSSRLDALDYEEKLE 161 +L L+KN+L G L + + RV + N RF+ L L + L+ Sbjct: 181 VLSLRKNVLNGSLPSSLSSLSGLRVLALANNRFNGALPDLSHLTNLQ 227 >At3g60630.1 68416.m06784 scarecrow transcription factor family protein scarecrow-like 6, Arabidopsis thaliana, EMBL:AF036303 Length = 623 Score = 31.1 bits (67), Expect = 0.70 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -3 Query: 345 GLNAPTRPDECQRLPAPTFSFSTTTVLSPHPGWPGG 238 G + PT + R P+P S STTT+ S H G GG Sbjct: 50 GFSEPTSVLDSVRSPSPFVSSSTTTLSSSHGGPSGG 85 >At3g14830.1 68416.m01873 expressed protein Length = 476 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 536 GLTKSQSMLPIQTDFSFFCKHSCGLLFLPII 444 GL ++Q P FS+ CK+ CG P++ Sbjct: 331 GLLQAQGQYPGDMRFSYSCKNKCGTRITPMV 361 >At5g58300.1 68418.m07298 leucine-rich repeat transmembrane protein kinase, putative Length = 654 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -3 Query: 297 PTFSFSTTTVLSPHPGWPGGTRQ-PPSLHPRCILPPL 190 P+ SFS T+L P P T PPSL P PPL Sbjct: 228 PSSSFSGNTLLCGLPLQPCATSSPPPSLTPHISTPPL 264 >At1g77480.2 68414.m09023 nucellin protein, putative similar to nucellin GB:AAB96882 GI:2290202 [Hordeum vulgare] (nucellin: similar to aspartic protease and its specific expression in nucellar cells during degeneration) Length = 432 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/60 (30%), Positives = 23/60 (38%) Frame = -1 Query: 626 CGSPTPSPGIHRPPSTSSTFSIGNNS*HFFGLTKSQSMLPIQTDFSFFCKHSCGLLFLPI 447 CG +PG H PP T+ +G GL+ L I + C G FL I Sbjct: 181 CGYDQQNPGPHPPPPTAGILGLGRGK---VGLSTQLKSLGITKNVIVHCLSHTGKGFLSI 237 >At1g77480.1 68414.m09022 nucellin protein, putative similar to nucellin GB:AAB96882 GI:2290202 [Hordeum vulgare] (nucellin: similar to aspartic protease and its specific expression in nucellar cells during degeneration) Length = 466 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/60 (30%), Positives = 23/60 (38%) Frame = -1 Query: 626 CGSPTPSPGIHRPPSTSSTFSIGNNS*HFFGLTKSQSMLPIQTDFSFFCKHSCGLLFLPI 447 CG +PG H PP T+ +G GL+ L I + C G FL I Sbjct: 181 CGYDQQNPGPHPPPPTAGILGLGRGK---VGLSTQLKSLGITKNVIVHCLSHTGKGFLSI 237 >At1g23190.1 68414.m02897 phosphoglucomutase, cytoplasmic, putative / glucose phosphomutase, putative strong similarity to SP|P93805 Phosphoglucomutase, cytoplasmic 2 (EC 5.4.2.2) (Glucose phosphomutase 2) (PGM 2) {Zea mays}; contains InterPro accession IPR006352: Phosphoglucosamine mutase Length = 583 Score = 28.7 bits (61), Expect = 3.8 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +2 Query: 263 DRTVVVEKEKVGAGSRWHSSGLVGAFK--PTLAQVRLAQSSIRLLKELEARGRPTGWKQC 436 D ++ +GA + SSGL G + PT A + + S+ L K E PTGWK Sbjct: 318 DSVAIIAANAIGA-IPYFSSGLKGVARSMPTSAALDVVAKSLNL-KFFEV---PTGWKFF 372 Query: 437 GSLL 448 G+L+ Sbjct: 373 GNLM 376 >At5g62570.1 68418.m07852 calmodulin-binding protein similar to calmodulin-binding protein TCB60 GI:1698548 from [Nicotiana tabacum] Length = 487 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 435 HCFHPVGLPRASSSLRSLIEDWASLT*ASVGLNAPTR 325 +C H +GL S L+S ++D+ S ASVG A ++ Sbjct: 428 NCSHILGLEEPQSELQSALDDFMSQKNASVGGKAHSK 464 >At2g23230.1 68415.m02774 terpene synthase/cyclase family protein Length = 611 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 481 QKNEKSVCIGSIDCDLVXPKKCHELFP 561 +K K VC+ + DCDLV ++ FP Sbjct: 36 RKPTKPVCVKTTDCDLVESQRTFNKFP 62 >At1g20550.1 68414.m02561 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'axi 1 protein -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 526 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 72 DKCNLYRVAGVLNRRFSSRLDALDY--EEKLEDCLSVLPSKAKVVICSG 212 +KC + RV VL +R + +L+ DY KL D L L + ++ SG Sbjct: 203 EKCYINRVLPVLQKRHAVQLNKFDYRLSNKLRDDLQKLRFEPDMLAFSG 251 >At5g18350.1 68418.m02159 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1193 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 389 LKELEARGRPTGWKQCGSLLLARTRDR 469 L++L+A + TGW GS ++ T+DR Sbjct: 322 LEQLDAMAKETGWFGYGSRIIITTQDR 348 >At5g67290.1 68418.m08484 FAD-dependent oxidoreductase family protein contains Pfam profile PF01266: FAD dependent oxidoreductase Length = 406 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 192 KVVICSGGVMRAAVAYHLANRG 257 +V +C GGV+ AY LA +G Sbjct: 41 RVFVCGGGVIGVCTAYFLAKKG 62 >At5g63710.1 68418.m07997 leucine-rich repeat transmembrane protein kinase, putative Length = 614 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 316 FIRPCWSIQANTCSGEACPVLN*AS*GA*GS 408 F+ PC+S TC G++ LN AS G G+ Sbjct: 77 FVSPCYSWSYVTCRGQSVVALNLASSGFTGT 107 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -3 Query: 342 LNAPTRPDECQRLPAPTFSFSTTTVLSPHPGWPGGTRQPPSLHP 211 ++ P PD PAPT +T P P PG T PP P Sbjct: 113 VSPPPPPDASPSPPAPT---TTNPPPKPSPSPPGETPSPPGETP 153 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 333 PTRPDECQRLPAPTFSFSTTTVLSPHPGWPGGTRQPPSLHP 211 P+ P E P P+ S T T + P P + PPS +P Sbjct: 146 PSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNP 186 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,703,767 Number of Sequences: 28952 Number of extensions: 393584 Number of successful extensions: 1239 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1237 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -