BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0397 (387 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X13382-1|CAA31759.1| 407|Drosophila melanogaster protein ( Dros... 97 7e-21 X06881-1|CAA29998.1| 123|Drosophila melanogaster protein ( Dros... 97 7e-21 BT025959-1|ABG02203.1| 233|Drosophila melanogaster IP15855p pro... 97 7e-21 AY069485-1|AAL39630.1| 401|Drosophila melanogaster LD21756p pro... 97 7e-21 AE014297-4196|AAG22173.1| 401|Drosophila melanogaster CG5502-PA... 97 7e-21 AY122259-1|AAM52771.1| 2176|Drosophila melanogaster SD09011p pro... 32 0.30 AL009192-2|CAA15686.1| 2342|Drosophila melanogaster EG:133E12.4 ... 32 0.30 AF242291-1|AAF63753.1| 2362|Drosophila melanogaster nuclear prot... 32 0.30 AE014298-308|AAF45704.2| 2301|Drosophila melanogaster CG4399-PB ... 32 0.30 BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p pro... 31 0.69 AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA... 31 0.69 AY071142-1|AAL48764.1| 572|Drosophila melanogaster RE17942p pro... 29 2.1 AF223064-1|AAF34687.1| 571|Drosophila melanogaster putative mic... 29 2.1 AE014297-195|AAF52059.2| 572|Drosophila melanogaster CG10229-PA... 29 2.1 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 28 3.7 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 28 3.7 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 28 3.7 AY118719-1|AAM50579.1| 512|Drosophila melanogaster AT29177p pro... 28 3.7 AF050630-1|AAD09205.1| 884|Drosophila melanogaster Ahr homolog ... 28 3.7 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 28 3.7 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 28 3.7 AE014297-2199|AAF55308.1| 884|Drosophila melanogaster CG6993-PA... 28 3.7 AE014134-2664|AAN10926.1| 62|Drosophila melanogaster CG31820-P... 28 3.7 AE014298-789|AAN09151.2| 312|Drosophila melanogaster CG15771-PB... 28 4.9 AE014298-788|AAF46077.4| 355|Drosophila melanogaster CG15771-PA... 28 4.9 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 27 6.4 DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375900-1|ABD37791.1| 430|Drosophila melanogaster catsup prote... 27 6.4 DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375847-1|ABD37738.1| 430|Drosophila melanogaster catsup prote... 27 6.4 DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup prote... 27 6.4 DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup prote... 27 6.4 AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p pro... 27 6.4 AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transm... 27 6.4 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 27 6.4 AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-P... 27 6.4 AE014134-592|AAS64618.1| 1205|Drosophila melanogaster CG3304-PC,... 27 6.4 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 27 6.4 U42403-1|AAB02355.1| 1180|Drosophila melanogaster stripe a prote... 27 8.5 U42402-1|AAB02354.1| 906|Drosophila melanogaster stripe b prote... 27 8.5 AY113210-1|AAM29215.1| 872|Drosophila melanogaster AT06220p pro... 27 8.5 AE014297-947|AAF54383.1| 1980|Drosophila melanogaster CG16779-PA... 27 8.5 AE014296-2188|AAF49882.2| 271|Drosophila melanogaster CG17666-P... 27 8.5 AE014296-2187|AAN11857.1| 872|Drosophila melanogaster CG17666-P... 27 8.5 >X13382-1|CAA31759.1| 407|Drosophila melanogaster protein ( Drosophila melanogastermRNA for put. ribosomal protein L1. ). Length = 407 Score = 97.1 bits (231), Expect = 7e-21 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 255 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGGRMFAP 386 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMC GGRMFAP Sbjct: 64 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP 107 Score = 80.2 bits (189), Expect = 9e-16 Identities = 39/64 (60%), Positives = 48/64 (75%) Frame = +1 Query: 67 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMXKNSRQLYCVSEE 246 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VSE Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 247 AGHK 258 AGH+ Sbjct: 61 AGHQ 64 >X06881-1|CAA29998.1| 123|Drosophila melanogaster protein ( Drosophila gene forribosomal protein L1 fragment. ). Length = 123 Score = 97.1 bits (231), Expect = 7e-21 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 255 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGGRMFAP 386 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMC GGRMFAP Sbjct: 2 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP 45 >BT025959-1|ABG02203.1| 233|Drosophila melanogaster IP15855p protein. Length = 233 Score = 97.1 bits (231), Expect = 7e-21 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 255 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGGRMFAP 386 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMC GGRMFAP Sbjct: 64 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP 107 Score = 80.2 bits (189), Expect = 9e-16 Identities = 39/64 (60%), Positives = 48/64 (75%) Frame = +1 Query: 67 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMXKNSRQLYCVSEE 246 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VSE Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 247 AGHK 258 AGH+ Sbjct: 61 AGHQ 64 >AY069485-1|AAL39630.1| 401|Drosophila melanogaster LD21756p protein. Length = 401 Score = 97.1 bits (231), Expect = 7e-21 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 255 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGGRMFAP 386 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMC GGRMFAP Sbjct: 64 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP 107 Score = 80.2 bits (189), Expect = 9e-16 Identities = 39/64 (60%), Positives = 48/64 (75%) Frame = +1 Query: 67 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMXKNSRQLYCVSEE 246 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VSE Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 247 AGHK 258 AGH+ Sbjct: 61 AGHQ 64 >AE014297-4196|AAG22173.1| 401|Drosophila melanogaster CG5502-PA protein. Length = 401 Score = 97.1 bits (231), Expect = 7e-21 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 255 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGGRMFAP 386 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMC GGRMFAP Sbjct: 64 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP 107 Score = 80.2 bits (189), Expect = 9e-16 Identities = 39/64 (60%), Positives = 48/64 (75%) Frame = +1 Query: 67 MSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMXKNSRQLYCVSEE 246 MSL ARPLVSVY+EK+E + LP VFKAPIRPD+VN+VH + +N+RQ Y VSE Sbjct: 1 MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSEL 60 Query: 247 AGHK 258 AGH+ Sbjct: 61 AGHQ 64 >AY122259-1|AAM52771.1| 2176|Drosophila melanogaster SD09011p protein. Length = 2176 Score = 31.9 bits (69), Expect = 0.30 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +3 Query: 240 RGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGG 371 RGG S T ES GT + V ++ R GG SG G + GG Sbjct: 918 RGGGSATHVESSGTLKTVIKLNRSSNGGVSGSGGLPTGTVIHGG 961 >AL009192-2|CAA15686.1| 2342|Drosophila melanogaster EG:133E12.4 protein. Length = 2342 Score = 31.9 bits (69), Expect = 0.30 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +3 Query: 240 RGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGG 371 RGG S T ES GT + V ++ R GG SG G + GG Sbjct: 1042 RGGGSATHVESSGTLKTVIKLNRSSNGGVSGSGGLPTGTVIHGG 1085 >AF242291-1|AAF63753.1| 2362|Drosophila melanogaster nuclear protein EAST protein. Length = 2362 Score = 31.9 bits (69), Expect = 0.30 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +3 Query: 240 RGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGG 371 RGG S T ES GT + V ++ R GG SG G + GG Sbjct: 1095 RGGGSATHVESSGTLKTVIKLNRSSNGGVSGSGGLPTGTVIHGG 1138 >AE014298-308|AAF45704.2| 2301|Drosophila melanogaster CG4399-PB protein. Length = 2301 Score = 31.9 bits (69), Expect = 0.30 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +3 Query: 240 RGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGG 371 RGG S T ES GT + V ++ R GG SG G + GG Sbjct: 1042 RGGGSATHVESSGTLKTVIKLNRSSNGGVSGSGGLPTGTVIHGG 1085 >BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p protein. Length = 175 Score = 30.7 bits (66), Expect = 0.69 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -3 Query: 370 PPQHMLPKAP*PDLWVPPPRTRGIRATARPVPHDSALVCDQPP 242 PP LP P P PPP T T P P + PP Sbjct: 62 PPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPP 104 >AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA protein. Length = 172 Score = 30.7 bits (66), Expect = 0.69 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -3 Query: 370 PPQHMLPKAP*PDLWVPPPRTRGIRATARPVPHDSALVCDQPP 242 PP LP P P PPP T T P P + PP Sbjct: 59 PPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPP 101 >AY071142-1|AAL48764.1| 572|Drosophila melanogaster RE17942p protein. Length = 572 Score = 29.1 bits (62), Expect = 2.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 343 P*PDLWVPPPRTRGIRATARPVPHDSAL 260 P PD+W PPP+ + +P P A+ Sbjct: 133 PDPDIWTPPPKDPDVWGPPKPPPTTQAV 160 >AF223064-1|AAF34687.1| 571|Drosophila melanogaster putative microtubule severingprotein katanin p60 subunit protein. Length = 571 Score = 29.1 bits (62), Expect = 2.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 343 P*PDLWVPPPRTRGIRATARPVPHDSAL 260 P PD+W PPP+ + +P P A+ Sbjct: 133 PDPDIWTPPPKDPDVWGPPKPPPTTQAV 160 >AE014297-195|AAF52059.2| 572|Drosophila melanogaster CG10229-PA protein. Length = 572 Score = 29.1 bits (62), Expect = 2.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 343 P*PDLWVPPPRTRGIRATARPVPHDSAL 260 P PD+W PPP+ + +P P A+ Sbjct: 133 PDPDIWTPPPKDPDVWGPPKPPPTTQAV 160 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 28.3 bits (60), Expect = 3.7 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = +3 Query: 234 RERGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGGRM 377 R+RGG SQ G G +R GGG G G GN GG M Sbjct: 347 RDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGG-GNRRDGGPM 393 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 28.3 bits (60), Expect = 3.7 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = +3 Query: 234 RERGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGGRM 377 R+RGG SQ G G +R GGG G G GN GG M Sbjct: 347 RDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGG-GNRRDGGPM 393 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 28.3 bits (60), Expect = 3.7 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = +3 Query: 234 RERGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGGRM 377 R+RGG SQ G G +R GGG G G GN GG M Sbjct: 342 RDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGG-GNRRDGGPM 388 >AY118719-1|AAM50579.1| 512|Drosophila melanogaster AT29177p protein. Length = 512 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAEFGQQH 286 HH+ HP + +HHH H E QH Sbjct: 438 HHHA--HPHPHSHHHHHHHHHHETAHQH 463 >AF050630-1|AAD09205.1| 884|Drosophila melanogaster Ahr homolog spineless protein. Length = 884 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAEFGQQH 286 HH+ HP + +HHH H E QH Sbjct: 810 HHHA--HPHPHSHHHHHHHHHHETAHQH 835 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 28.3 bits (60), Expect = 3.7 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = +3 Query: 234 RERGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGGRM 377 R+RGG SQ G G +R GGG G G GN GG M Sbjct: 342 RDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGG-GNRRDGGPM 388 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 28.3 bits (60), Expect = 3.7 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = +3 Query: 234 RERGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGGRM 377 R+RGG SQ G G +R GGG G G GN GG M Sbjct: 342 RDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGG-GNRRDGGPM 388 >AE014297-2199|AAF55308.1| 884|Drosophila melanogaster CG6993-PA protein. Length = 884 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAEFGQQH 286 HH+ HP + +HHH H E QH Sbjct: 810 HHHA--HPHPHSHHHHHHHHHHETAHQH 835 >AE014134-2664|AAN10926.1| 62|Drosophila melanogaster CG31820-PA protein. Length = 62 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +2 Query: 272 MGYRTCCC-PNSACXWWWYP*VRSGC 346 M Y CCC PN C W P R C Sbjct: 26 MNYNNCCCGPNPPCGPWTCPPNRCCC 51 >AE014298-789|AAN09151.2| 312|Drosophila melanogaster CG15771-PB, isoform B protein. Length = 312 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -1 Query: 342 PDRTYGYHHH---XHAEFGQQHVRYPMIRHW 259 P +GYHHH H E QQH + R W Sbjct: 256 PGAGHGYHHHHHQQHQEQQQQHHHHHHQRQW 286 >AE014298-788|AAF46077.4| 355|Drosophila melanogaster CG15771-PA, isoform A protein. Length = 355 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -1 Query: 342 PDRTYGYHHH---XHAEFGQQHVRYPMIRHW 259 P +GYHHH H E QQH + R W Sbjct: 299 PGAGHGYHHHHHQQHQEQQQQHHHHHHQRQW 329 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = +3 Query: 234 RERGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGG 371 R RGG +G GR RGGG R G+G FG GG Sbjct: 30 RGRGGGGGGGGGGFGGGRG-------RGGGGDRGGRGGFGGGRGGG 68 >DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375900-1|ABD37791.1| 430|Drosophila melanogaster catsup protein protein. Length = 430 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 76 HHHHGHDHDHDHDHGHHHHGHDE 98 >DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375847-1|ABD37738.1| 430|Drosophila melanogaster catsup protein protein. Length = 430 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 76 HHHHGHDHDHDHDHGHHHHGHDE 98 >DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transmembrane protein Catecholaminesup protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 27.5 bits (58), Expect = 6.4 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -3 Query: 370 PPQHMLPKAP*PDLWVPPPRTRGIRATARPVPHDSALVCDQPP 242 PP + AP P ++VPPP T+ + T P P +V PP Sbjct: 142 PPTKKVVIAP-PPVYVPPP-TKKVVYTPPPPPPTKKVVYTPPP 182 Score = 27.5 bits (58), Expect = 6.4 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -3 Query: 370 PPQHMLPKAP*PDLWVPPPRTRGIRATARPVPHDSALVCDQPP 242 PP + AP P ++VPPP T+ + T P P +V PP Sbjct: 255 PPTKKVVIAP-PPVYVPPP-TKKVIYTPPPPPPTKKVVYTPPP 295 >AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-PA protein. Length = 449 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAE 301 HH+ + D +G+HHH H E Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE 117 >AE014134-592|AAS64618.1| 1205|Drosophila melanogaster CG3304-PC, isoform C protein. Length = 1205 Score = 27.5 bits (58), Expect = 6.4 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = -1 Query: 369 HHNTCYRRHPDRTYGYHHHXHAEFGQQHVRYPMIRHW 259 HH+ H D + +HHH ++P HW Sbjct: 941 HHHGSQHHHHDARHSHHHHHQPLLPHHQQQHP--HHW 975 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = +3 Query: 234 RERGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCCGG 371 R RGG +G GR RGGG R G+G FG GG Sbjct: 23 RGRGGGGGGGGGGFGGGRG-------RGGGGDRGGRGGFGGGRGGG 61 >U42403-1|AAB02355.1| 1180|Drosophila melanogaster stripe a protein protein. Length = 1180 Score = 27.1 bits (57), Expect = 8.5 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 Query: 345 HPDRTYGYHHHXHAEFGQQH 286 H + +GYHHH H H Sbjct: 631 HQQQQFGYHHHHHHHHHHHH 650 >U42402-1|AAB02354.1| 906|Drosophila melanogaster stripe b protein protein. Length = 906 Score = 27.1 bits (57), Expect = 8.5 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 Query: 345 HPDRTYGYHHHXHAEFGQQH 286 H + +GYHHH H H Sbjct: 357 HQQQQFGYHHHHHHHHHHHH 376 >AY113210-1|AAM29215.1| 872|Drosophila melanogaster AT06220p protein. Length = 872 Score = 27.1 bits (57), Expect = 8.5 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 284 TCCCP-NSACXWWWYP*VRSGC 346 TCC P ++ C W WY +GC Sbjct: 718 TCCMPCSNQCPWSWYYNPCTGC 739 >AE014297-947|AAF54383.1| 1980|Drosophila melanogaster CG16779-PA protein. Length = 1980 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = -3 Query: 151 TEGAWLHPAPSHSSLNTPTLKVGL-PIDSF 65 T+G+++ PAP HSS T TL+ + ++SF Sbjct: 721 TKGSFVVPAPPHSSGTTTTLRRSISDLESF 750 >AE014296-2188|AAF49882.2| 271|Drosophila melanogaster CG17666-PB, isoform B protein. Length = 271 Score = 27.1 bits (57), Expect = 8.5 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 284 TCCCP-NSACXWWWYP*VRSGC 346 TCC P ++ C W WY +GC Sbjct: 117 TCCMPCSNQCPWSWYYNPCTGC 138 >AE014296-2187|AAN11857.1| 872|Drosophila melanogaster CG17666-PA, isoform A protein. Length = 872 Score = 27.1 bits (57), Expect = 8.5 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 284 TCCCP-NSACXWWWYP*VRSGC 346 TCC P ++ C W WY +GC Sbjct: 718 TCCMPCSNQCPWSWYYNPCTGC 739 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,243,918 Number of Sequences: 53049 Number of extensions: 408403 Number of successful extensions: 2376 Number of sequences better than 10.0: 199 Number of HSP's better than 10.0 without gapping: 1680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2317 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1066083345 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -