BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0394 (741 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 76 3e-14 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 66 3e-11 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 62 6e-10 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 58 7e-09 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 50 3e-06 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 49 3e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 48 6e-06 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 44 1e-04 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 43 3e-04 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 42 4e-04 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 42 5e-04 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 40 0.003 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 40 0.003 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 36 0.026 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 36 0.034 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 34 0.11 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 34 0.14 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 34 0.14 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 30 1.7 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 30 2.3 SB_51151| Best HMM Match : Vicilin_N (HMM E-Value=0.19) 29 3.0 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 29 3.0 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 80.2 bits (189), Expect = 2e-15 Identities = 37/71 (52%), Positives = 48/71 (67%) Frame = +2 Query: 497 KEFSGVAKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 ++ G+AKTGSGKT A++ PA+VHI +QP ++ GDGPI L+ APTREL QQI A FG Sbjct: 555 RDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFG 614 Query: 677 HTSYVRNTCVF 709 + VF Sbjct: 615 KAYNIHVVAVF 625 Score = 73.3 bits (172), Expect = 2e-13 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 4/100 (4%) Frame = +3 Query: 258 QPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKT 437 +PFNKNFY+ HP + K+S E+++ R + VSG P F F + + ++ Sbjct: 475 KPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDEQMMASIRK 534 Query: 438 MGYKEPTPIQAQGWPIAMSGKNLVA*PK----RVPAKRWP 545 + Y +PT IQ Q PIA+SG++++ K + A WP Sbjct: 535 LEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWP 574 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 75.8 bits (178), Expect = 3e-14 Identities = 33/55 (60%), Positives = 43/55 (78%) Frame = +2 Query: 545 YILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVF 709 +ILP IVHIN+QP ++ GDGPI LVL PTRELAQQ+Q+VA G +R+TC++ Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIY 167 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = +3 Query: 306 RSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 473 R +EV+ YR + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 66.1 bits (154), Expect = 3e-11 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 4/74 (5%) Frame = +2 Query: 497 KEFSGVAKTGSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQIQQVA 664 ++ GVA+TGSGKT A+ +P +V I P I R + GP AL+LAPTRELAQQI++ Sbjct: 139 RDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEI 198 Query: 665 ADFGHTSYVRNTCV 706 FG +R V Sbjct: 199 LKFGRPLGIRTVSV 212 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/60 (33%), Positives = 37/60 (61%) Frame = +3 Query: 330 YRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 509 +R + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + ++++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 62.5 bits (145), Expect = 3e-10 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 4/107 (3%) Frame = +3 Query: 258 QPFNKNFYDPHPTVLKRSPYEVEEYRNNHE-VTVSGVEVHNPIQYFEEANFPDYVQQGVK 434 QPF K+FY P + K +P E +E+R + E + V G P++ + + + +K Sbjct: 62 QPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLK 121 Query: 435 TMGYKEPTPIQAQGWPIAMSGKNLVA---*PKRVPAKRWPTSCQPLC 566 Y++PTPIQAQ P+ MSG++++A P R A + C+ C Sbjct: 122 KNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKFC 168 Score = 36.7 bits (81), Expect = 0.020 Identities = 21/59 (35%), Positives = 29/59 (49%) Frame = +2 Query: 533 KTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVF 709 K +Y P + P I G IA+V+ PTRELA QI + F + +R CV+ Sbjct: 121 KKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVY 179 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 61.7 bits (143), Expect = 6e-10 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = +2 Query: 497 KEFSGVAKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 652 ++ G+A+TGSGKTLAY LP + + + P GD P+AL+L PTREL QQ+ Sbjct: 110 RDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 49.2 bits (112), Expect = 3e-06 Identities = 28/101 (27%), Positives = 48/101 (47%) Frame = +3 Query: 264 FNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 443 F ++YD + V + S V+E R + + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 444 YKEPTPIQAQGWPIAMSGKNLVA*PKRVPAKRWPTSCQPLC 566 ++ PTPIQ Q MSG++++ + K S PLC Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSL-PLC 131 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 58.0 bits (134), Expect = 7e-09 Identities = 27/91 (29%), Positives = 48/91 (52%) Frame = +3 Query: 279 YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 458 Y HPT+ + +V++ R+ E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 459 PIQAQGWPIAMSGKNLVA*PKRVPAKRWPTS 551 PIQ Q P+ +SG++++ K P+S Sbjct: 221 PIQMQVLPVLLSGRDVMVCASTGSGKLLPSS 251 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/63 (44%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +2 Query: 497 KEFSGVAKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 ++ A+TGSGKT AY+LP + + Q P+AL +APTRELA+QI A F Sbjct: 517 RDLMACAQTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFS 576 Query: 677 -HT 682 HT Sbjct: 577 DHT 579 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +3 Query: 354 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 512 VSG I F E F + + + GY+ PTP+Q PI M+G++L+A Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMA 521 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 49.6 bits (113), Expect = 3e-06 Identities = 28/61 (45%), Positives = 38/61 (62%) Frame = +2 Query: 497 KEFSGVAKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 ++ G AKTGSGKTLA+++P I + Q DG ALV++PTRELA Q +V G Sbjct: 88 RDVLGAAKTGSGKTLAFLIPIIETLWRQKWTSM-DGLGALVISPTRELAYQTFEVLVKIG 146 Query: 677 H 679 + Sbjct: 147 N 147 Score = 31.9 bits (69), Expect = 0.56 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +3 Query: 381 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 509 ++ F + G+ G+ PT IQ QG P+A+SG++++ Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVL 91 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 49.2 bits (112), Expect = 3e-06 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 1/75 (1%) Frame = +2 Query: 431 KDNGLQRTDAHSSSRLADSYVWKEFSGVAKTGSGKTLAYILPAIVHINN-QPPIRRGDGP 607 +D G+ +S Y ++ G A+TG+GKTL++ LP + + + + +RG P Sbjct: 89 EDRGITYLFPIQASTFNYIYDGEDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAP 148 Query: 608 IALVLAPTRELAQQI 652 LV+APTRELA+Q+ Sbjct: 149 KVLVMAPTRELAKQV 163 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +3 Query: 318 EVEEYRNNHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 485 ++ +R+ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 486 AMSG 497 G Sbjct: 197 MAHG 200 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +2 Query: 545 YILPAIVHINNQPPIRRG---DGPIALVLAPTRELAQQI 652 Y P + + P + G G A+V++PTRELAQQI Sbjct: 183 YTTPTPIQMQATPLMAHGPKKSGFRAVVVSPTRELAQQI 221 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 48.4 bits (110), Expect = 6e-06 Identities = 27/80 (33%), Positives = 43/80 (53%) Frame = +2 Query: 431 KDNGLQRTDAHSSSRLADSYVWKEFSGVAKTGSGKTLAYILPAIVHINNQPPIRRGDGPI 610 KD G +A ++ G AKTGSGKTLA+++P +V + + + +G Sbjct: 588 KDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVP-VVELLYKLQFKTRNGTG 646 Query: 611 ALVLAPTRELAQQIQQVAAD 670 ++++PTREL+ Q VA D Sbjct: 647 VIIISPTRELSLQTYGVARD 666 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 46.8 bits (106), Expect = 2e-05 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Frame = +2 Query: 497 KEFSGVAKTGSGKTLAYILPAIVHINN----QPPIRRGDGPIALVLAPTRELAQQIQQVA 664 ++ A+TGSGKT A++LP + + N P A+ +APTRELA QI A Sbjct: 749 RDVMACAQTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEA 808 Query: 665 ADFGHTSYVR 694 F H + +R Sbjct: 809 RKFAHGTMLR 818 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/56 (39%), Positives = 32/56 (57%) Frame = +3 Query: 345 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 512 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++++A Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMA 753 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 46.4 bits (105), Expect = 2e-05 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Frame = +2 Query: 515 AKTGSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAADFGHTSYV 691 A++G+GKT + + + I+ + G D ALVLAPTRELAQQIQ+V G +V Sbjct: 129 AQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHV 188 Query: 692 R-NTCV 706 + + C+ Sbjct: 189 KCHACI 194 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/56 (39%), Positives = 32/56 (57%) Frame = +3 Query: 345 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 512 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++++A Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMA 176 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/70 (32%), Positives = 40/70 (57%) Frame = +2 Query: 497 KEFSGVAKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 K+ +A+TGSGKT A+++P + G AL+L+PTRELA Q Q+ + G Sbjct: 319 KDVVAMARTGSGKTAAFLIPMFEKLQTHTA---KVGIRALILSPTRELALQTQKFIKELG 375 Query: 677 HTSYVRNTCV 706 + ++++ + Sbjct: 376 RFTGLKSSVI 385 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/48 (52%), Positives = 30/48 (62%) Frame = +2 Query: 509 GVAKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 652 G AKTGSGKT A+ LP + + + P G A+VL PTRELA QI Sbjct: 49 GCAKTGSGKTAAFALPILQKLCDDP-----YGIFAVVLTPTRELAFQI 91 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 42.3 bits (95), Expect = 4e-04 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 5/66 (7%) Frame = +2 Query: 515 AKTGSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQIQQVAADFGH 679 A+TGSGKTLAY+ P +VH + R G P A ++ P RELA QI + A H Sbjct: 422 AQTGSGKTLAYLAP-LVHRLREDEERHGILARLKRPRACIVVPARELATQILKTAKSLCH 480 Query: 680 TSYVRN 697 + R+ Sbjct: 481 HARFRS 486 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/60 (41%), Positives = 34/60 (56%) Frame = +2 Query: 497 KEFSGVAKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 K+ G+A+TGSGKT A+ LP + + + P AL+L PTRELA QI + G Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNP-----QRLFALILTPTRELAFQISEQCEALG 56 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = +2 Query: 515 AKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYV 691 A++G+GKT + + + I+ Q +R P ALVL+PTRELA QIQ+V G + S Sbjct: 41 AQSGTGKTATFSISVLQAIDTQ--LRE---PQALVLSPTRELANQIQKVVLALGDYMSVQ 95 Query: 692 RNTCV 706 + C+ Sbjct: 96 CHACI 100 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/89 (33%), Positives = 46/89 (51%), Gaps = 15/89 (16%) Frame = +2 Query: 434 DNGLQRTDAHSSSRLADSYVW-KEFSGVAKTGSGKTLAYILPAIVHIN-------NQPPI 589 D G + S + + ++ ++ G A+TGSGKTLA+ +P I HI Q P Sbjct: 147 DQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTLAFGIPIIQHIEAYKKRKAEQSPS 206 Query: 590 -------RRGDGPIALVLAPTRELAQQIQ 655 +G +AL++APTRELA Q++ Sbjct: 207 DKESDLESQGYPLLALIMAPTRELALQVK 235 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/54 (40%), Positives = 30/54 (55%) Frame = +2 Query: 515 AKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 AK G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 91 AKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +3 Query: 390 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA*PKRVPAK 536 FE+ + G+ G+ +P+PIQ + P+A++G++++A K K Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/54 (40%), Positives = 30/54 (55%) Frame = +2 Query: 515 AKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 AK G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 91 AKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +3 Query: 390 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA*PKRVPAK 536 FE+ + G+ G+ +P+PIQ + P+A++G++++A K K Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 36.3 bits (80), Expect = 0.026 Identities = 21/61 (34%), Positives = 34/61 (55%) Frame = +2 Query: 467 SSRLADSYVWKEFSGVAKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQ 646 +S + + + K+ A TG+GKT A++LP + + +P + LV+ PTRELA Sbjct: 38 ASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYRP--TQSPAIRVLVITPTRELAI 95 Query: 647 Q 649 Q Sbjct: 96 Q 96 Score = 32.7 bits (71), Expect = 0.32 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 423 QGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 512 + V +G+ PTPIQA P+A+ GK++ A Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCA 52 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 35.9 bits (79), Expect = 0.034 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +2 Query: 497 KEFSGVAKTGSGKTLAYILPAIVHINNQPPIRR---GDGPIALVLAPTRELAQQIQQVAA 667 ++ +GVA GSGK LAY+LP I I + +GP+ L+L + ++ V Sbjct: 225 RDVAGVAIEGSGKRLAYLLPIIHQITESSVYQELPLANGPLVLILCTNWQNTARVYGVCE 284 Query: 668 D 670 D Sbjct: 285 D 285 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 515 AKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYV 691 ++TG+GK+L ++LP++ Q P RG G I ++ PTRELA Q + +V+ G S V Sbjct: 204 SETGTGKSLVFLLPSV-----QDP-GRGYGTI--IVVPTRELASQMLYEVSRLLGDKSIV 255 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 33.9 bits (74), Expect = 0.14 Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +2 Query: 605 PIALVLAPTRELAQQIQQVAADFG-HTSYVRNTCV 706 P ALVL+PTRELA QIQ+V G + S + C+ Sbjct: 4 PQALVLSPTRELANQIQKVVLALGDYMSVQCHACI 38 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 381 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 512 I FE+ + + + V GYK+PTP+Q PI ++L+A Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMA 917 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 497 KEFSGVAKTGSGKTLAYILPAIVHINNQPP 586 ++ A+TGSGKT A+++P + I + P Sbjct: 913 RDLMACAQTGSGKTAAFLIPILSRIYMEGP 942 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Frame = +2 Query: 515 AKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYV 691 +++G+GKT A++L + ++ P P + L+PT ELA+Q +VA G H ++ Sbjct: 149 SQSGTGKTAAFVLTMLSRVDATKPY-----PQVICLSPTYELARQTGKVAEAMGKHCPHI 203 Query: 692 R 694 + Sbjct: 204 K 204 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +3 Query: 342 HEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 494 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +3 Query: 366 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 479 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/54 (31%), Positives = 30/54 (55%) Frame = +2 Query: 515 AKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 AK+G+GKT + + A+ ++ I + ++L PTRE+A Q++ V G Sbjct: 57 AKSGTGKTCVFSVIALENV-----ITESNCIQIIILTPTREIAVQVKDVICAIG 105 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 276 FYDPHPTVLKRSPYEVEEYRNN--HEVTVSGVEVHNPIQYFEEANFPDY 416 + D VL E EE NN H++ + + +HNP YFE+ + DY Sbjct: 217 YRDEDDGVLVPIEQEAEEEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_51151| Best HMM Match : Vicilin_N (HMM E-Value=0.19) Length = 493 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = -3 Query: 169 YCHRCQIEKNYRRICCLL----QIWNHRFHGYYSSYQT*LFF 56 +CHR Q NY C ++ Q+W+H + SS ++ +F+ Sbjct: 178 FCHRQQYRHNYYNSCLVITFFRQMWDHLWANVGSSVESSVFY 219 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +2 Query: 515 AKTGSGKTLAYILPAIVHINNQPPIRRGDGPIA-LVLAPTRELAQQIQQ 658 AK+G GKT ++L + + P+ DG ++ LV+ TRELA QI + Sbjct: 91 AKSGMGKTAVFVLATLQQLE---PV---DGQVSVLVMCHTRELAFQIHK 133 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +2 Query: 515 AKTGSGKTLAYILPAIVHINNQPPIRRGDGPIA-LVLAPTRELAQQIQQ 658 AK+G GKT ++L + + P+ DG ++ LV+ TRELA QI + Sbjct: 91 AKSGMGKTAVFVLATLQQLE---PV---DGQVSVLVMCHTRELAFQIHK 133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,388,377 Number of Sequences: 59808 Number of extensions: 476417 Number of successful extensions: 1297 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1281 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -