BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0393 (506 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0092 - 22759791-22760676,22761446-22761813,22762202-227622... 29 2.1 03_06_0116 + 31773295-31773603,31773800-31773946,31774080-317741... 29 2.8 01_05_0735 - 24749975-24750601,24751411-24751541,24752150-247523... 27 8.7 >04_04_0092 - 22759791-22760676,22761446-22761813,22762202-22762207, 22763365-22763603,22764808-22765339 Length = 676 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 288 NSELAAKVMIDLLGTYTDENASYA 359 ++ +A KV ID++GT+TD YA Sbjct: 653 DASIAVKVSIDVIGTWTDSETLYA 676 >03_06_0116 + 31773295-31773603,31773800-31773946,31774080-31774158, 31777558-31778180 Length = 385 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 16 AFSQRLTKAPGPKLGMVALQSLWRLYNNLEPNSPLRYHVY 135 AFS+R K PK + L W L+ + P +R H+Y Sbjct: 227 AFSKRTKKGKLPKEARLKLLHWWELHYDKWPYPSVRTHIY 266 >01_05_0735 - 24749975-24750601,24751411-24751541,24752150-24752336, 24753801-24753898,24754182-24754689 Length = 516 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +1 Query: 61 MVALQSLWRLYNNLEPNSPLRYHVYYHVIELAARVGFVREV 183 ++A L +Y +L PN PL+ +Y+ +I +A + F+ ++ Sbjct: 195 LLAADCLEIMYTSLSPNGPLK--LYHFIIIVAVALAFLSQL 233 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,810,091 Number of Sequences: 37544 Number of extensions: 177769 Number of successful extensions: 422 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -