BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0392 (708 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 21 7.4 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 7.4 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 9.8 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 9.8 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 9.8 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 7.4 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 409 LTNI*FYLLNCLITTE-PIFFAFQRLQTQKINIFKFITDVK 290 L +I F + IT + PI+ ++T K+N+FK I ++K Sbjct: 378 LRDIIFAIRQHAITAKFPIYLYRMSVET-KLNVFKRIGNIK 417 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.4 bits (43), Expect = 7.4 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 409 LTNI*FYLLNCLITTE-PIFFAFQRLQTQKINIFKFITDVK 290 L +I F + IT + PI+ ++T K+N+FK I ++K Sbjct: 380 LRDIIFAIRQHAITAKFPIYLYRMSVET-KLNVFKRIGNIK 419 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.0 bits (42), Expect = 9.8 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +2 Query: 347 CKKYWFCCNQT 379 C +YW C N T Sbjct: 112 CTRYWTCWNGT 122 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.0 bits (42), Expect = 9.8 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 139 FVQFLAILNEDERRHRVNVVLAGDVLALINV 47 F+Q LAI+ E E R V L D N+ Sbjct: 328 FIQLLAIVPEKEESSRQAVNLICDKFERSNI 358 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 9.8 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 139 FVQFLAILNEDERRHRVNVVLAGDVLALINV 47 F+Q LAI+ E E R V L D N+ Sbjct: 328 FIQLLAIVPEKEESSRQAVNLICDKFERSNI 358 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,803 Number of Sequences: 336 Number of extensions: 3499 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -