BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0392 (708 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060458-1|AAL25497.1| 114|Drosophila melanogaster SD03042p pro... 50 2e-06 AF220362-1|AAF37263.1| 106|Drosophila melanogaster thioredoxin ... 50 2e-06 AE014134-1667|AAN10701.1| 106|Drosophila melanogaster CG31884-P... 50 2e-06 AE014134-1666|AAN10700.1| 106|Drosophila melanogaster CG31884-P... 50 2e-06 AJ507731-1|CAD45644.1| 157|Drosophila melanogaster thioredoxinT... 44 2e-04 AE014298-718|AAF46018.2| 157|Drosophila melanogaster CG3315-PA ... 44 2e-04 BT023024-1|AAY55440.1| 139|Drosophila melanogaster IP04051p pro... 37 0.023 BT022989-1|AAY55405.1| 139|Drosophila melanogaster IP04151p pro... 37 0.023 AE014296-2414|AAF49714.1| 139|Drosophila melanogaster CG13473-P... 37 0.023 L27072-1|AAA28937.1| 107|Drosophila melanogaster thioredoxin-li... 34 0.22 AE014298-719|AAF46019.1| 107|Drosophila melanogaster CG4193-PA ... 34 0.22 AY089550-1|AAL90288.1| 287|Drosophila melanogaster LD26837p pro... 33 0.50 AF143404-1|AAF66635.1| 287|Drosophila melanogaster thioredoxin-... 33 0.50 AE014296-996|AAF50750.1| 287|Drosophila melanogaster CG5495-PA ... 33 0.50 AY051709-1|AAK93133.1| 416|Drosophila melanogaster LD24756p pro... 30 3.5 AE014298-1673|AAF48082.2| 416|Drosophila melanogaster CG1837-PA... 30 3.5 >AY060458-1|AAL25497.1| 114|Drosophila melanogaster SD03042p protein. Length = 114 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +2 Query: 71 ASEYNINSMPTFVFVKNGKKLDEFSGAN 154 A EYNI+SMPTFVF+KNG K++EF+GAN Sbjct: 75 AMEYNISSMPTFVFLKNGVKVEEFAGAN 102 >AF220362-1|AAF37263.1| 106|Drosophila melanogaster thioredoxin protein. Length = 106 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +2 Query: 71 ASEYNINSMPTFVFVKNGKKLDEFSGAN 154 A EYNI+SMPTFVF+KNG K++EF+GAN Sbjct: 67 AMEYNISSMPTFVFLKNGVKVEEFAGAN 94 >AE014134-1667|AAN10701.1| 106|Drosophila melanogaster CG31884-PB, isoform B protein. Length = 106 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +2 Query: 71 ASEYNINSMPTFVFVKNGKKLDEFSGAN 154 A EYNI+SMPTFVF+KNG K++EF+GAN Sbjct: 67 AMEYNISSMPTFVFLKNGVKVEEFAGAN 94 >AE014134-1666|AAN10700.1| 106|Drosophila melanogaster CG31884-PA, isoform A protein. Length = 106 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = +2 Query: 71 ASEYNINSMPTFVFVKNGKKLDEFSGAN 154 A EYNI+SMPTFVF+KNG K++EF+GAN Sbjct: 67 AMEYNISSMPTFVFLKNGVKVEEFAGAN 94 >AJ507731-1|CAD45644.1| 157|Drosophila melanogaster thioredoxinT protein. Length = 157 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +2 Query: 77 EYNINSMPTFVFVKNGKKLDEFSGANVD 160 EYN+NSMPTFVF+K G L+ F G N D Sbjct: 69 EYNVNSMPTFVFIKGGNVLELFVGCNSD 96 >AE014298-718|AAF46018.2| 157|Drosophila melanogaster CG3315-PA protein. Length = 157 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +2 Query: 77 EYNINSMPTFVFVKNGKKLDEFSGANVD 160 EYN+NSMPTFVF+K G L+ F G N D Sbjct: 69 EYNVNSMPTFVFIKGGNVLELFVGCNSD 96 >BT023024-1|AAY55440.1| 139|Drosophila melanogaster IP04051p protein. Length = 139 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 71 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 160 A +Y +NSMPTF+ +KN L +F G NV+ Sbjct: 74 AVQYEVNSMPTFLIIKNRVTLIQFVGGNVE 103 >BT022989-1|AAY55405.1| 139|Drosophila melanogaster IP04151p protein. Length = 139 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 71 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 160 A +Y +NSMPTF+ +KN L +F G NV+ Sbjct: 74 AVQYEVNSMPTFLIIKNRVTLIQFVGGNVE 103 >AE014296-2414|AAF49714.1| 139|Drosophila melanogaster CG13473-PA protein. Length = 139 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 71 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 160 A +Y +NSMPTF+ +KN L +F G NV+ Sbjct: 74 AVQYEVNSMPTFLIIKNRVTLIQFVGGNVE 103 >L27072-1|AAA28937.1| 107|Drosophila melanogaster thioredoxin-like protein protein. Length = 107 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +2 Query: 80 YNINSMPTFVFVKNGKKLDEFSGAN 154 Y + SMPTFVF++ ++L F+GA+ Sbjct: 69 YKVRSMPTFVFLRQNRRLASFAGAD 93 >AE014298-719|AAF46019.1| 107|Drosophila melanogaster CG4193-PA protein. Length = 107 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +2 Query: 80 YNINSMPTFVFVKNGKKLDEFSGAN 154 Y + SMPTFVF++ ++L F+GA+ Sbjct: 69 YKVRSMPTFVFLRQNRRLASFAGAD 93 >AY089550-1|AAL90288.1| 287|Drosophila melanogaster LD26837p protein. Length = 287 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 71 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 160 A+ +++MPTF+F +N K+D GA+V+ Sbjct: 67 AAGQGVSAMPTFIFYRNRTKIDRVQGADVN 96 >AF143404-1|AAF66635.1| 287|Drosophila melanogaster thioredoxin-like protein TXL protein. Length = 287 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 71 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 160 A+ +++MPTF+F +N K+D GA+V+ Sbjct: 67 AAGQGVSAMPTFIFYRNRTKIDRVQGADVN 96 >AE014296-996|AAF50750.1| 287|Drosophila melanogaster CG5495-PA protein. Length = 287 Score = 32.7 bits (71), Expect = 0.50 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 71 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 160 A+ +++MPTF+F +N K+D GA+V+ Sbjct: 67 AAGQGVSAMPTFIFYRNRTKIDRVQGADVN 96 >AY051709-1|AAK93133.1| 416|Drosophila melanogaster LD24756p protein. Length = 416 Score = 29.9 bits (64), Expect = 3.5 Identities = 8/25 (32%), Positives = 20/25 (80%) Frame = +2 Query: 77 EYNINSMPTFVFVKNGKKLDEFSGA 151 ++ + PT +++++GKK++++SGA Sbjct: 233 DFEVKGYPTLLWIEDGKKIEKYSGA 257 >AE014298-1673|AAF48082.2| 416|Drosophila melanogaster CG1837-PA protein. Length = 416 Score = 29.9 bits (64), Expect = 3.5 Identities = 8/25 (32%), Positives = 20/25 (80%) Frame = +2 Query: 77 EYNINSMPTFVFVKNGKKLDEFSGA 151 ++ + PT +++++GKK++++SGA Sbjct: 233 DFEVKGYPTLLWIEDGKKIEKYSGA 257 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,007,313 Number of Sequences: 53049 Number of extensions: 453960 Number of successful extensions: 805 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3128965752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -