BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0390 (767 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12446| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_31647| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_53541| Best HMM Match : GST_C (HMM E-Value=0.02) 48 6e-06 SB_47009| Best HMM Match : WSC (HMM E-Value=0.16) 48 8e-06 SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 41 0.001 SB_53542| Best HMM Match : GST_C (HMM E-Value=0.018) 39 0.005 SB_39252| Best HMM Match : PEX11 (HMM E-Value=6.4e-35) 30 2.4 SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) 29 3.1 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) 29 4.1 SB_5070| Best HMM Match : TPR_2 (HMM E-Value=1.4e-13) 28 7.2 >SB_12446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 615 Score = 61.7 bits (143), Expect = 6e-10 Identities = 29/80 (36%), Positives = 49/80 (61%) Frame = +1 Query: 517 SKKGQLPFVELNGEEIADSTFIIKDLSEKYNKDLDAGLTSEQRVISHAMISMIENHLSWV 696 S K ++PF+E G+++ D+ F IK L++K+N D DA L++EQ+ + HA+ +M E + W Sbjct: 317 SSKEKVPFIEYQGDKVQDTNFCIKYLNKKFNVDPDAHLSAEQKAMCHAIQAMAEENTYWS 376 Query: 697 ILWWRAKYPDSVIKGYQVNL 756 + ++R K Y NL Sbjct: 377 LAYYRWVDNYQETKKYYSNL 396 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +2 Query: 389 VYLYQFSRTPLLPSTSPYCLKVETWLRLAGIKYEN 493 V L+Q P +P P LK+ET+LR+ I YEN Sbjct: 275 VILHQHPPGPTIPGFLPNSLKLETYLRMVKIPYEN 309 >SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 61.3 bits (142), Expect = 8e-10 Identities = 25/65 (38%), Positives = 45/65 (69%) Frame = +1 Query: 517 SKKGQLPFVELNGEEIADSTFIIKDLSEKYNKDLDAGLTSEQRVISHAMISMIENHLSWV 696 S K ++PF+E G+++ D+ F IK L++K+N D DA L++EQ+ + HA+ +M E + W Sbjct: 81 SSKEKVPFIEYQGDKVQDTNFCIKYLNKKFNVDPDAHLSAEQKAMCHAIQAMAEENTYWS 140 Query: 697 ILWWR 711 + ++R Sbjct: 141 LAYYR 145 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +2 Query: 389 VYLYQFSRTPLLPSTSPYCLKVETWLRLAGIKYEN 493 V L+Q P +P P LK+ET+LR+ I YEN Sbjct: 39 VILHQHPPGPTIPGFLPNSLKLETYLRMVKIPYEN 73 >SB_31647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 51.2 bits (117), Expect = 9e-07 Identities = 19/56 (33%), Positives = 40/56 (71%) Frame = +1 Query: 517 SKKGQLPFVELNGEEIADSTFIIKDLSEKYNKDLDAGLTSEQRVISHAMISMIENH 684 S KG++P++E NG+ +ADS F ++ L++++ DLDA L+++ R ++ + M++ + Sbjct: 71 SSKGKIPWIEYNGQCVADSNFCVEFLNKEFGVDLDAKLSAKDRAVARTLAVMLDEN 126 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/38 (50%), Positives = 26/38 (68%) Frame = +2 Query: 380 KDVVYLYQFSRTPLLPSTSPYCLKVETWLRLAGIKYEN 493 K VV L Q + +PS SP+ LK+E++LRLA I Y+N Sbjct: 27 KGVVLLRQPAVATTVPSISPFPLKLESYLRLAKIPYKN 64 >SB_53541| Best HMM Match : GST_C (HMM E-Value=0.02) Length = 256 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/63 (33%), Positives = 37/63 (58%) Frame = +1 Query: 523 KGQLPFVELNGEEIADSTFIIKDLSEKYNKDLDAGLTSEQRVISHAMISMIENHLSWVIL 702 K +P VE +G+ + S I L+E+Y +LD L+ EQ+ + + +M++ H SW +L Sbjct: 53 KVNMPAVEYDGKVVVHSARCIPYLNERYGVELDRDLSEEQKATATTITAMLDEHTSWTLL 112 Query: 703 WWR 711 + R Sbjct: 113 YHR 115 Score = 35.5 bits (78), Expect = 0.048 Identities = 15/29 (51%), Positives = 23/29 (79%) Frame = +2 Query: 401 QFSRTPLLPSTSPYCLKVETWLRLAGIKY 487 +F++ P+ PS SP CLK+ET+ R+A I+Y Sbjct: 15 RFAKLPV-PSISPSCLKLETYARMANIQY 42 >SB_47009| Best HMM Match : WSC (HMM E-Value=0.16) Length = 852 Score = 48.0 bits (109), Expect = 8e-06 Identities = 20/57 (35%), Positives = 36/57 (63%) Frame = +1 Query: 514 RSKKGQLPFVELNGEEIADSTFIIKDLSEKYNKDLDAGLTSEQRVISHAMISMIENH 684 +S KG+ P++E G+ +ADS F I+ L+ ++ DLD GL+ + ++ A M+E + Sbjct: 644 KSSKGKFPWIEHKGKHVADSQFCIEYLTREFGVDLDEGLSEADKAVATAFRVMLEEN 700 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/40 (50%), Positives = 29/40 (72%), Gaps = 2/40 (5%) Frame = +2 Query: 377 EKDVVYLYQFSRTPLLP--STSPYCLKVETWLRLAGIKYE 490 +++ V L+QF R P LP + SP CLK+ETW+R+A I Y+ Sbjct: 598 DQNPVILHQFPRNPRLPVPNISPPCLKLETWMRMAKIPYD 637 >SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 1432 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/41 (43%), Positives = 28/41 (68%) Frame = +1 Query: 517 SKKGQLPFVELNGEEIADSTFIIKDLSEKYNKDLDAGLTSE 639 S KG+LP++E G+ IADS F + L++++ D+D LT E Sbjct: 1190 SSKGKLPWIEYQGKSIADSNFCVDFLNKEFFVDVDEHLTVE 1230 >SB_53542| Best HMM Match : GST_C (HMM E-Value=0.018) Length = 261 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/63 (26%), Positives = 34/63 (53%) Frame = +1 Query: 523 KGQLPFVELNGEEIADSTFIIKDLSEKYNKDLDAGLTSEQRVISHAMISMIENHLSWVIL 702 K +P +E + + + S I L+E+Y +LD L+ EQ+ + + +M++ SW + Sbjct: 59 KVNMPAIEYDDKVVVHSARCIPYLNERYGLELDRDLSEEQKATATTITAMLDEKTSWTLH 118 Query: 703 WWR 711 + R Sbjct: 119 YHR 121 Score = 35.5 bits (78), Expect = 0.048 Identities = 15/29 (51%), Positives = 23/29 (79%) Frame = +2 Query: 401 QFSRTPLLPSTSPYCLKVETWLRLAGIKY 487 +F++ P+ PS SP CLK+ET+ R+A I+Y Sbjct: 21 RFAKLPV-PSISPSCLKLETYARMANIQY 48 >SB_39252| Best HMM Match : PEX11 (HMM E-Value=6.4e-35) Length = 239 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = -3 Query: 621 IKIFVVFLGKIFDDESAI-----GYFFAIQFHERQLAFFGTILA*CSTFSYLMPAKRS 463 +++ + +G + D +A+ G+ +A + + FGTI + C ++YL PAK S Sbjct: 176 LELLISIVGSLADAVNAVHWSCPGFLWAGCLPKSAIGLFGTISSVCLMYNYLYPAKPS 233 >SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) Length = 843 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +1 Query: 556 EEIADSTFIIKDLSEKYNKDLDAGLTSEQRVI 651 EE+ T I+KD++ +Y ++L A + ++V+ Sbjct: 608 EEVKQETIIVKDVARRYYRELRAAIDEGEKVL 639 >SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2839 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 162 LQNKFNSNMTV-EVTNNIPENAPEKEKDMKEDRRPIMANPKRL 287 ++NK N +T E T PEN EK+ K R N +RL Sbjct: 634 MENKENIEITKSEKTQEAPENTTEKDDSKKRSRNRSERNKRRL 676 >SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) Length = 348 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +3 Query: 225 PEKEKDMKEDRRPIMANPKRLHYLMRKAMKNLKRKNPNQLSRNQ 356 P++ +K+ R+P NP H K +K +K K +L++ + Sbjct: 19 PQRNVYVKKRRKPASRNPSSQHKKTEKKLKKVKEKVDQKLTKGK 62 >SB_5070| Best HMM Match : TPR_2 (HMM E-Value=1.4e-13) Length = 732 Score = 28.3 bits (60), Expect = 7.2 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 472 GRH*VRERRASCQYRSKKGQLPFVELNGEEIADSTFIIKDLSEKYNKDLDAGLT--SEQR 645 G H ++ R+++ + GQ+P + ++ S F K L+E KDL L S QR Sbjct: 181 GSHQIQNRKSAAELAEYCGQMPLLIEIAAKLVTSGFNPKMLAETMKKDLYRVLNQRSYQR 240 Query: 646 VI 651 V+ Sbjct: 241 VV 242 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,143,319 Number of Sequences: 59808 Number of extensions: 450065 Number of successful extensions: 3222 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3220 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -