BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0390 (767 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 26 1.5 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 24 5.9 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 7.9 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 25.8 bits (54), Expect = 1.5 Identities = 10/39 (25%), Positives = 17/39 (43%) Frame = +2 Query: 419 LLPSTSPYCLKVETWLRLAGIKYENVEHHANIVPKKANC 535 L+P +K +A + + +HH I P+K C Sbjct: 732 LIPGIDVNAVKAAAEEAVASVSHWMAQHHLQIAPEKTEC 770 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 666 LHDREPPVVGDSLVARQVPGQCY 734 L DR+ PV +Q+P QCY Sbjct: 354 LLDRQSPVAEAQTQQQQLPTQCY 376 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 7.9 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +3 Query: 402 NFRALLCYRRHPHIA*KLKHGFVWPALSTRT*SIMPISFQKRPTAVRGTEWRRNSR 569 NF CYRRH A KL + + P+++ + + +GT R S+ Sbjct: 1526 NFCHPYCYRRHMRAATKLIRAI--RKIYGDEFGVTPVTYAQPSESAKGTTRRERSK 1579 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,342 Number of Sequences: 2352 Number of extensions: 16646 Number of successful extensions: 47 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -