BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0389 (717 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0052 - 12833004-12833057,12833917-12833955,12834231-128346... 30 2.1 12_01_0705 + 6065932-6066061,6066150-6066883,6066962-6067423,606... 29 3.7 11_01_0582 - 4632377-4632677,4632757-4632927,4633010-4633842,463... 29 3.7 10_03_0045 - 7353148-7353448,7353528-7353698,7353781-7354613,735... 29 3.7 07_03_0729 - 21025525-21025825,21025905-21026075,21026158-210269... 29 3.7 06_03_0262 + 18905352-18905481,18905570-18906003,18906082-189063... 29 3.7 04_01_0582 - 7558115-7558415,7558495-7558665,7558748-7559189,755... 29 3.7 04_01_0224 - 2830669-2830969,2831049-2831219,2831302-2832134,283... 29 3.7 04_01_0118 - 1223530-1223830,1223910-1224080,1224163-1224995,122... 29 3.7 12_02_0938 - 24576419-24576719,24576817-24576969,24577052-245778... 29 4.9 12_02_0311 + 17361153-17361282,17361371-17362104,17362183-173626... 29 4.9 12_02_0161 + 14659338-14659467,14659553-14659888,14660034-146602... 29 4.9 12_02_0096 - 13573612-13573632,13573846-13573884,13574160-135744... 29 4.9 12_01_0775 - 7070620-7070920,7071000-7071170,7071253-7072085,707... 29 4.9 11_06_0747 - 26867114-26867225,26868443-26868531,26869342-268693... 29 4.9 11_04_0390 - 17108441-17108654,17108821-17108991,17109074-171091... 29 4.9 11_04_0247 + 15313008-15313137,15313226-15313959,15314038-153141... 29 4.9 08_02_1612 + 28226138-28226267,28226356-28227089,28227168-282276... 29 4.9 08_02_1391 + 26668539-26668668,26668757-26669490,26669569-266700... 29 4.9 08_02_0942 - 22845270-22845570,22845650-22845820,22845903-228467... 29 4.9 08_02_0712 - 20329967-20330267,20330347-20330517,20330600-203314... 29 4.9 08_02_0331 - 15852164-15852464,15852544-15852714,15852797-158536... 29 4.9 08_02_0327 + 15821587-15821716,15821805-15822538,15822617-158230... 29 4.9 08_02_0223 - 14452059-14452359,14452439-14452609,14452692-144532... 29 4.9 08_01_0258 - 2112170-2112470,2112550-2112720,2112803-2113635,211... 29 4.9 07_03_1513 - 27327702-27328604,27329957-27329995,27330413-273306... 29 4.9 07_03_0783 + 21501013-21501142,21501231-21501964,21502043-215025... 29 4.9 07_03_0422 + 18015230-18015359,18015448-18016181,18016260-180167... 29 4.9 07_03_0139 + 14143383-14143512,14143601-14144334,14144413-141448... 29 4.9 07_01_0943 - 7959813-7960113,7960193-7960363,7960446-7961278,796... 29 4.9 07_01_0811 - 6377328-6377628,6377708-6377878,6377961-6378145,637... 29 4.9 06_03_1348 - 29497084-29497384,29497464-29497634,29497717-294985... 29 4.9 06_03_0771 + 24473176-24473203,24473292-24474025,24474104-244745... 29 4.9 06_03_0463 - 21038166-21038466,21038546-21038716,21038799-210396... 29 4.9 06_01_1148 + 9629630-9629759,9629848-9630581,9630660-9631121,963... 29 4.9 06_01_1107 + 9120664-9120793,9120882-9121615,9121694-9123069,912... 29 4.9 05_07_0218 + 28470325-28470454,28470543-28471276,28471355-284718... 29 4.9 05_07_0085 - 27591909-27592152,27592232-27592402,27592485-275926... 29 4.9 05_03_0464 + 14350391-14350520,14350609-14351342,14351421-143518... 29 4.9 05_03_0399 + 13517874-13518003,13518092-13518825,13518904-135193... 29 4.9 04_04_0067 + 22498987-22499116,22499205-22499938,22500017-225004... 29 4.9 04_03_0262 + 13597021-13597150,13597239-13597972,13598051-135985... 29 4.9 04_02_0023 + 8655524-8655653,8655742-8656475,8656553-8656918,865... 29 4.9 04_01_0496 + 6517881-6518010,6518099-6518832,6518911-6519372,651... 29 4.9 03_06_0623 + 35160081-35160210,35160299-35161032,35161111-351615... 29 4.9 03_05_0088 + 20664580-20664696,20664796-20665218,20665297-206655... 29 4.9 02_05_0268 - 27302734-27303034,27303114-27303284,27303367-273041... 29 4.9 02_04_0153 - 20330775-20330831,20330913-20330999,20333119-203331... 29 4.9 02_03_0337 + 17898732-17899370,17899516-17899977,17900058-179006... 29 4.9 01_03_0306 + 14875755-14876822 29 4.9 01_03_0195 - 13674138-13674438,13674518-13674688,13674771-136756... 29 4.9 01_02_0132 + 11444480-11444609,11444698-11445131,11445210-114454... 29 4.9 01_01_0035 - 275285-275308,275390-275851,275930-276663,276752-27... 29 4.9 04_03_0574 - 17338777-17339077,17339390-17340222,17340304-173407... 28 6.4 01_06_1389 - 36969414-36969436,36970027-36970394,36970474-369706... 28 6.4 11_06_0576 - 25127807-25128107,25128241-25128357,25128730-251292... 28 8.5 02_05_0030 + 25209067-25209130,25209231-25209400,25210482-252116... 28 8.5 >07_03_0052 - 12833004-12833057,12833917-12833955,12834231-12834651, 12834731-12834901,12834984-12835816,12835898-12836359, 12836438-12837171,12837260-12837389 Length = 947 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWSS Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSS 100 >12_01_0705 + 6065932-6066061,6066150-6066883,6066962-6067423, 6067505-6068337,6068420-6068590,6068670-6068919, 6069367-6069405,6069598-6069672 Length = 897 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R +N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSHNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >11_01_0582 - 4632377-4632677,4632757-4632927,4633010-4633842, 4633924-4634385,4634464-4635197,4635286-4635415 Length = 876 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R +N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSHNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >10_03_0045 - 7353148-7353448,7353528-7353698,7353781-7354613, 7354695-7355156,7355235-7355968,7356057-7356186 Length = 876 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R +N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSHNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >07_03_0729 - 21025525-21025825,21025905-21026075,21026158-21026990, 21027072-21027533,21027612-21028345,21028434-21028563 Length = 876 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R +N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSHNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >06_03_0262 + 18905352-18905481,18905570-18906003,18906082-18906303, 18906381-18906842,18906935-18907755,18907838-18908008, 18908088-18908347,18908453-18908508,18908786-18908824, 18909711-18909764 Length = 882 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIRQVDASGRPTAPRTV-IGRWSN 100 >04_01_0582 - 7558115-7558415,7558495-7558665,7558748-7559189, 7559301-7559580,7559662-7560123,7560202-7560935, 7561024-7561153 Length = 839 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -3 Query: 229 TNHMSWMRPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 ++ S R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 54 SSETSASRSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >04_01_0224 - 2830669-2830969,2831049-2831219,2831302-2832134, 2832216-2832677,2832756-2833489,2833578-2833707 Length = 876 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNSRSQNIWPTIVQVIREVDASGRPTAPRTV-IGRWSN 100 >04_01_0118 - 1223530-1223830,1223910-1224080,1224163-1224995, 1225077-1225538,1225617-1226350,1226439-1226568 Length = 876 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIRQVDASGRPTAPRTV-IGRWSN 100 >12_02_0938 - 24576419-24576719,24576817-24576969,24577052-24577884, 24577966-24578427,24578506-24579213 Length = 818 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 9 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 48 >12_02_0311 + 17361153-17361282,17361371-17362104,17362183-17362644, 17362726-17363558,17363641-17363811,17363891-17364191 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >12_02_0161 + 14659338-14659467,14659553-14659888,14660034-14660266, 14660344-14660805,14660887-14661719,14661802-14661972, 14662052-14662352 Length = 821 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 62 RSSRNPWSQNIWPTTVLVIREVDASGRPTAPRTV-IGRWSN 101 >12_02_0096 - 13573612-13573632,13573846-13573884,13574160-13574493, 13574660-13574830,13574913-13575730,13575812-13576114, 13576352-13577085,13577174-13577303 Length = 849 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >12_01_0775 - 7070620-7070920,7071000-7071170,7071253-7072085, 7072167-7072628,7072707-7073440,7073529-7073658 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >11_06_0747 - 26867114-26867225,26868443-26868531,26869342-26869380, 26869819-26870077,26870157-26870327,26870410-26870451, 26870896-26871242,26871324-26871785,26871864-26872597, 26872686-26872815 Length = 794 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >11_04_0390 - 17108441-17108654,17108821-17108991,17109074-17109115, 17109364-17109905,17109987-17110448,17110527-17111260, 17111349-17111478 Length = 764 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >11_04_0247 + 15313008-15313137,15313226-15313959,15314038-15314169, 15314179-15314499,15314581-15314888,15315007-15315411, 15315494-15315664,15315744-15316002,15316443-15316481, 15317619-15317750 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >08_02_1612 + 28226138-28226267,28226356-28227089,28227168-28227629, 28227711-28228543,28228626-28228796,28228876-28229176 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >08_02_1391 + 26668539-26668668,26668757-26669490,26669569-26670030, 26670112-26670944,26671364-26671577 Length = 790 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >08_02_0942 - 22845270-22845570,22845650-22845820,22845903-22846735, 22846817-22847278,22847357-22848090,22848179-22848308 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >08_02_0712 - 20329967-20330267,20330347-20330517,20330600-20331432, 20331514-20331975,20332054-20332787,20332876-20333005 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >08_02_0331 - 15852164-15852464,15852544-15852714,15852797-15853629, 15853711-15854172,15854251-15854984,15855073-15855202 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >08_02_0327 + 15821587-15821716,15821805-15822538,15822617-15823078, 15823160-15823992,15824075-15824245,15824325-15824625 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >08_02_0223 - 14452059-14452359,14452439-14452609,14452692-14453299, 14453393-14453524,14453606-14454067,14454146-14454979 Length = 835 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 51 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 90 >08_01_0258 - 2112170-2112470,2112550-2112720,2112803-2113635, 2113717-2114178,2114257-2114990,2115079-2115208 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >07_03_1513 - 27327702-27328604,27329957-27329995,27330413-27330692, 27330772-27330942,27331025-27331857,27331939-27332400, 27332479-27333212,27333301-27333430 Length = 1183 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >07_03_0783 + 21501013-21501142,21501231-21501964,21502043-21502504, 21502586-21503418,21503501-21503671,21503751-21504051 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >07_03_0422 + 18015230-18015359,18015448-18016181,18016260-18016721, 18016803-18017635,18017718-18017888,18017968-18018268 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >07_03_0139 + 14143383-14143512,14143601-14144334,14144413-14144874, 14144956-14145788,14145871-14146041,14146121-14146379, 14146828-14146866,14147903-14147989 Length = 904 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >07_01_0943 - 7959813-7960113,7960193-7960363,7960446-7961278, 7961360-7961821,7961899-7962606 Length = 824 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 9 RSSRNPRSQNIWPTIVQVIREVDASGRPTAPRTV-IGRWSN 48 >07_01_0811 - 6377328-6377628,6377708-6377878,6377961-6378145, 6378255-6378797,6378879-6379304,6379383-6380116, 6380205-6380334 Length = 829 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >06_03_1348 - 29497084-29497384,29497464-29497634,29497717-29498549, 29498631-29499092,29499171-29499904,29499993-29500122 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >06_03_0771 + 24473176-24473203,24473292-24474025,24474104-24474565, 24474647-24475479,24475562-24475732,24475812-24476112 Length = 842 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 27 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 66 >06_03_0463 - 21038166-21038466,21038546-21038716,21038799-21039631, 21039713-21040174,21040253-21040986,21041075-21041204 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >06_01_1148 + 9629630-9629759,9629848-9630581,9630660-9631121, 9631203-9632035,9632118-9632288,9632368-9632668 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >06_01_1107 + 9120664-9120793,9120882-9121615,9121694-9123069, 9123152-9123322,9123402-9123702 Length = 903 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRIV-IGRWSN 100 >05_07_0218 + 28470325-28470454,28470543-28471276,28471355-28471816, 28471898-28472730,28472813-28472983,28473063-28473180 Length = 815 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >05_07_0085 - 27591909-27592152,27592232-27592402,27592485-27592648, 27592775-27593317,27593399-27593860,27593939-27594672, 27594761-27594890 Length = 815 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >05_03_0464 + 14350391-14350520,14350609-14351342,14351421-14351882, 14351964-14352796,14352879-14352948,14352964-14353049, 14353129-14353429 Length = 871 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >05_03_0399 + 13517874-13518003,13518092-13518825,13518904-13519365, 13519447-13520279,13520362-13520532,13520612-13520912 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >04_04_0067 + 22498987-22499116,22499205-22499938,22500017-22500478, 22500560-22501392,22501475-22501645,22501725-22502025 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >04_03_0262 + 13597021-13597150,13597239-13597972,13598051-13598512, 13598594-13599136,13599385-13599426,13599594-13599679, 13599759-13600017,13600456-13600494,13603624-13603737 Length = 802 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >04_02_0023 + 8655524-8655653,8655742-8656475,8656553-8656918, 8657062-8657183,8657210-8657786 Length = 642 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >04_01_0496 + 6517881-6518010,6518099-6518832,6518911-6519372, 6519454-6519575,6519735-6520286,6520369-6520539, 6520619-6520919 Length = 823 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >03_06_0623 + 35160081-35160210,35160299-35161032,35161111-35161572, 35161654-35162486,35162569-35162739,35162819-35163119 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >03_05_0088 + 20664580-20664696,20664796-20665218,20665297-20665518, 20665597-20666058,20666140-20666300,20666422-20666973, 20667056-20667125,20667141-20667226,20667306-20667673, 20668002-20668018 Length = 825 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 53 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 92 >02_05_0268 - 27302734-27303034,27303114-27303284,27303367-27304199, 27304281-27304742,27304821-27305554,27305643-27305772 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >02_04_0153 - 20330775-20330831,20330913-20330999,20333119-20333157, 20333596-20333754,20334035-20334104,20334187-20335035, 20335270-20335562,20335640-20336347 Length = 753 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 9 RSSRNPRSQNIWPTTVQVIREVDASGRPTVPRTV-IGRWSN 48 >02_03_0337 + 17898732-17899370,17899516-17899977,17900058-17900688, 17900819-17900888,17900971-17901141,17901221-17901479, 17901918-17901956,17902900-17902914 Length = 761 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 9 RSSRNPRSQNIWPTTLQVIREVDASGRPTAPRTV-IGRWSN 48 >01_03_0306 + 14875755-14876822 Length = 355 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/26 (61%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +1 Query: 175 TNCYNRSTGWAASNSY--DLS*LPCR 246 TNCYN STG A NS+ DLS P R Sbjct: 91 TNCYNSSTGSANVNSWWMDLSTSPYR 116 >01_03_0195 - 13674138-13674438,13674518-13674688,13674771-13675603, 13675685-13676146,13676225-13676958,13677047-13677176 Length = 876 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >01_02_0132 + 11444480-11444609,11444698-11445131,11445210-11445431, 11445510-11445971,11446053-11446885,11446968-11447138, 11447218-11447518 Length = 850 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >01_01_0035 - 275285-275308,275390-275851,275930-276663,276752-276881 Length = 449 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 100 >04_03_0574 - 17338777-17339077,17339390-17340222,17340304-17340765, 17340843-17341030,17341244-17341576,17341665-17341796, 17342604-17342643 Length = 762 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R V A GRP P + + RWS+ Sbjct: 75 RSSRNPRSQNIWPTTVQVIREVDASGRPTAPKTV-IGRWSN 114 >01_06_1389 - 36969414-36969436,36970027-36970394,36970474-36970644, 36970727-36971559,36971642-36972103,36972182-36972915, 36973004-36973133 Length = 906 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 208 RPNRYYGCNNLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 R +R N+WP V+R + A GRP P + + RWS+ Sbjct: 61 RSSRNPRSQNIWPTTVQVIREIDASGRPTAPRTV-IGRWSN 100 >11_06_0576 - 25127807-25128107,25128241-25128357,25128730-25129271, 25129353-25129814,25129893-25130626,25130715-25130742 Length = 727 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 181 NLWPCCCWVLRCVRA-GRPYTPHCLRVARWSS 89 N+WP V+R V A GRP P + + RWS+ Sbjct: 36 NIWPTTVQVIREVDASGRPTAPRTV-IGRWSN 66 >02_05_0030 + 25209067-25209130,25209231-25209400,25210482-25211668, 25211695-25212011,25212669-25213374,25214248-25215448 Length = 1214 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 235 TRTNHMSWMRPNRYYGCNNLWP 170 TR +H+ W R R C +LWP Sbjct: 406 TRKHHLIWPRRARLVDCLDLWP 427 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,180,140 Number of Sequences: 37544 Number of extensions: 287465 Number of successful extensions: 660 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 660 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -