BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0385 (676 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0019 - 129767-129931,130078-130257,130491-130728,130833-13... 29 2.6 03_05_1117 - 30526126-30526640,30527114-30527186,30527310-305278... 28 7.8 >05_01_0019 - 129767-129931,130078-130257,130491-130728,130833-131236, 131284-131427,131709-131995,132071-132150,132563-132714, 132793-132909,133292-133450,133546-133946,134106-134423, 135050-135095,135203-135310 Length = 932 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 272 HK*TKNV*TNPRVYKRDETGASHAGDPGVYEGQIYR 379 HK +K+V +P + K GA+HAGDP GQ ++ Sbjct: 50 HKGSKSVFASP-LEKIQPNGANHAGDPETPGGQAFK 84 >03_05_1117 - 30526126-30526640,30527114-30527186,30527310-30527848, 30528215-30528332 Length = 414 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +3 Query: 549 RDSAAPLSCGISISKVWKIQ*SL*KASVVNATAT**ISPA 668 R + A L CG+ +++VWK++ + +N+T + +SPA Sbjct: 214 RSAMAKLKCGVDLAEVWKME-----DNGINSTPSAEVSPA 248 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,905,349 Number of Sequences: 37544 Number of extensions: 305296 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -