BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0385 (676 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07520.1 68416.m00896 glutamate receptor family protein (GLR1... 30 1.6 At2g40475.1 68415.m04995 expressed protein 28 5.0 >At3g07520.1 68416.m00896 glutamate receptor family protein (GLR1.4) plant glutamate receptor family, PMID:11379626 Length = 861 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -3 Query: 269 TCLCFGYFTSLYTHRIR----MDLFCRVPKKYIILLINDLYTHSLV*IGTI 129 T LCFG+ T ++ HR R M F + + +L++ YT +L + T+ Sbjct: 607 TLLCFGFSTLVFAHRERLQHNMSRFVVIVWIFAVLILTSNYTATLTSVMTV 657 >At2g40475.1 68415.m04995 expressed protein Length = 193 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 512 RPSNNRHASFEISLRIPNYSPVYRLYNISHTDDDK 408 RP +HA F SLR+P +P Y+ S + +K Sbjct: 46 RPGTPKHALFSESLRLPPLTPPPSYYSSSSSSGNK 80 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,109,845 Number of Sequences: 28952 Number of extensions: 261754 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -