BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0379 (802 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 24 4.8 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 24 6.3 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 24 6.3 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 8.3 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 8.3 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 8.3 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 8.3 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 8.3 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 8.3 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 8.3 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 8.3 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 8.3 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 8.3 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 8.3 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 24.2 bits (50), Expect = 4.8 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 790 LADACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLD 680 + D C E +V T R APP+N PR V + Sbjct: 622 MIDGCFEEGENAIVPTPPTTRRPIAPPKNFPRGKVYE 658 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 673 LHDREPPVVGDSLVARQVPGQCY 741 L DR+ PV +Q+P QCY Sbjct: 354 LLDRQSPVAEAQTQQQQLPTQCY 376 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -1 Query: 109 AKQQPNCLPAAPVWGLLYNNLFQAN*MKPRAASPSS 2 A++QP+ + AP G+ Y L+Q + P +S Sbjct: 70 ARKQPDKIYVAPAAGVTYFTLYQKVRLNPNLMEENS 105 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 105 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 157 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 97 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 149 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 97 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 149 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 97 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 149 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 97 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 149 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 105 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 157 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 129 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 181 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 97 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 149 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 105 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 157 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 97 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 149 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.4 bits (48), Expect = 8.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 784 DACSAHSEIHLVSLNNTVRVLGAPPENHPRQVVLDHGDHGVRYNPLLRRQTS-IKI 620 D S H H ++ +L + + H R +V H DH +N ++RR+ S +KI Sbjct: 105 DIKSQHETRHGDEVHGQYSLLDS--DGHQR-IVDYHADHHTGFNAVVRREPSAVKI 157 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 811,853 Number of Sequences: 2352 Number of extensions: 17509 Number of successful extensions: 49 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -